KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_3311Help
Entry
SHJGH_3311        CDS       T02531                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SHJGH_3311
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SHJGH_3311
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SHJGH_3311
Enzymes [BR:sho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SHJGH_3311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3816212..3817882
Genome map
AA seq 556 aa AA seqDB search
MTSRYRSSEASQGLGPLSPRRRTVVKAAAATAVLAGPLAAATSARAATDAPAFLHGVASG
DPLPDGVLLWTRVTPAPEAIPGSGLGPDTEVSWVVARDKAFTSIVAKGSTTATAASDHTV
KADIRGLEPATDYWFRFSAGGTDSPVARTRTAPAADADVSSLRFGVVSCANWEAGYFSAY
RHLAARNDLDAWLHLGDYIYEYESGEYGTRGTVVRPHAPAHEILTLADYRIRHARYKTDP
DLQALHLKAPVVAIWDDHEFADNAWSGGAVNHTEGAEGTWTARQAAAKQAYFEWMPVRPA
VAGTTYRRLRFGKLADLSLLDLRSFRSQQASTAGGSVDDPDRTLTGRAQLDWLKAGLKAS
DTRWRLVGNSVMISPFSFGSLSADLLKPLAKLLGLPQEGIAANTDQWDGYTDDRRELLAH
LRSNAIGNTVFLTGDIHMAWANDVPVDAGTYPLSASAATEFVVTSVTSDNLDDIVKVPEG
TVSAIAAPVIKAANRHVHWVDTDRHGYGVLDITADRAQMDYYALSDRTDANATSSWVRSY
RTRSGTQKVERTYDPV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgatacagatcatccgaggcctcccagggcctcggtccgctttcgccccgc
cgccgtacggtcgtcaaggccgcggcggcgaccgctgtcctggccggcccgctggccgcc
gcgacgtcggcccgcgccgccacggacgcccccgccttcctgcacggtgtcgcctccggc
gacccgctgcccgacggcgtgctgctgtggacccgggtgaccccggccccggaggcgata
ccgggttcgggactcggcccggacaccgaggtcagctgggtcgtcgccagggacaaggcg
ttcaccagcatcgtcgccaagggctccaccaccgcgacggccgcctccgaccacaccgtg
aaggccgacatccgcggcctggagccggccaccgactactggttccgcttctcggccggc
ggcaccgactccccggtggcgcgcacccgcaccgcgccggcggcggacgcggacgtctcc
tccttgcgcttcggcgtggtctcctgcgccaactgggaggccggctacttctccgcctac
cgccacctcgcggcccggaacgacctggatgcctggctgcacctcggcgactacatctac
gagtacgagtccggcgagtacgggacccggggcacggtcgtccgcccgcatgcgcctgcc
catgagatcctcaccctcgccgactaccggatccggcacgccaggtacaagaccgacccc
gacctccaggccctgcacctgaaggcaccggtcgtcgcgatctgggacgaccacgagttc
gccgacaacgcctggtcgggcggcgccgtcaaccacaccgagggcgccgagggcacctgg
acggcccgtcaggccgccgcgaaacaggcctacttcgagtggatgccggtccgcccggcc
gtcgcgggcaccacctaccgccggctgcgcttcggcaagctcgccgacctctccctgctg
gacctgcgctccttccgctcccagcaggcgtccacggccggcggctcggtggacgacccg
gaccgcacgctcaccgggcgcgcccagctcgactggctgaaggccggtctgaaggcctcc
gacaccaggtggcggctggtcggcaactcggtgatgatctcgccgttctccttcggctcc
ctctccgccgacctgctcaagccgctcgccaagctgctcggactgccgcaggagggcatc
gccgccaacaccgaccagtgggacggctacaccgacgaccgccgcgaactgctggcccac
ctgcgctccaacgccatcggcaacaccgtcttcctgaccggtgacatccacatggcgtgg
gccaacgacgtcccggttgacgcgggcacctacccgctgtcggcgtcggcggccaccgag
ttcgtggtgacctcggtgacctccgacaacctggacgacatcgtgaaggtgcccgagggc
acggtctcggcgatcgccgcgccggtcatcaaggccgccaaccggcacgtccactgggtg
gacaccgaccggcacggctacggcgtgctcgacatcaccgcggaccgcgcgcagatggac
tactacgcgctgtccgaccgcaccgacgcgaacgccacctccagctgggtgcgttcctac
cgcacccgcagcggcacgcagaaggtcgagcggacctacgacccggtgtga

DBGET integrated database retrieval system