KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_3371Help
Entry
SHJGH_3371        CDS       T02531                                 

Definition
putative esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3882900..3883688
Genome map
AA seq 262 aa AA seqDB search
MKHMPVLPGAEPYRHEGGEVGVLLCHGFTGSPQSLRPWAEHHAAHGLTVSLPLLPGHGTR
WEDMQLTTWQDWYAQVDRELRLLTERCSRVFVAGLSMGGALALRLAARHGERVAGAVVVN
PANKVHGLSAYALPVARHLVRTTKGIASDIAKEGAAELGYDRVPLHAAHSLRVFLRRLDG
ELPRVTQPLLLLRSARDHVVPAADSARVLSRVSATDVTEIVLEHSYHVATLDNDADRIFE
ESLAFIGRLAPSVGKEGTAAVG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcacatgccagttctccccggagccgagccgtaccgccacgagggcggtgaggtg
ggggttctcctctgccacggcttcaccggctcgccccagtcgctgcgcccctgggcggag
caccacgcggcccacggcctgaccgtctccctgccgctgctgcccggccacggcacccgc
tgggaggacatgcagctcaccacctggcaggactggtacgcgcaggtggaccgtgaactg
cggctgctcaccgagcgctgctcccgggtgttcgtcgcgggcctgtcgatgggcggggcg
ctggccctcaggctcgcggcccggcacggcgagcgggtggcgggcgcggtggtcgtcaac
ccggccaacaaggtgcacggcctgtcggcgtacgcccttccggtggcccggcacctggtg
cggacgacgaaaggcatcgccagcgacatcgcgaaggagggcgcggccgagctggggtac
gaccgggtgccgctgcacgcggcgcactcgctgcgggtgttcctgcgccggctggacggc
gagctgccccgggtcacgcagccgctgctgctgctgcgcagcgcccgggaccatgtcgtc
ccggcggccgactcggcgcgggtgctgagccgggtgtcggccacggacgtcacggagatc
gtgctggaacacagctaccacgtggcgacgttggacaacgacgcggaccggatcttcgag
gagagcctcgccttcatcggccggctcgcacccagtgtcggcaaggaagggacggccgca
gttggctga

DBGET integrated database retrieval system