KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_3915Help
Entry
SHJGH_3915        CDS       T02531                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sho00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4470009..4472081)
Genome map
AA seq 690 aa AA seqDB search
MAAAPDEHPTEDLARLAGLHGVDTSYRPAPDRTVQVPASAVTAALAALGVDAAGPDAVRA
ALAARERELRERLLPPTVVQWAGAEPPAALTALPAGTRLRVETEDGAERDGAGDLPLGVH
RLTATAPDGRTGEACLVIAPDRLPAPPGRSYGLLVQLYSLLSRRSWGMGDLADLAELAGW
AGRTAGAGFVQVNPLHAAVPGAPTDPSPYRPSSRRFPDPVHLRVEDVPEYAYAEDRERLD
GLLERAGRLRAAVLDKGALIDRDAVWELKRQALELVARVPLGPGRQAAYDAFRAAHGRAL
DDHATWCALAEVHGSDWHRWPDGLRDPRSAATARAREELADRVEFHTRLAWLTDGQLRAA
QRAAREAGMPVGIVHDLAVGVHPAGADAWAQQDVFAAGMSVGAPPDAFNARGQDWGLPPW
RPDRLAATGHAPYRDLLRALFRYAGALRIDHVMGLFRLWWVPQGSPPTDGTYVRYDADAM
LAILALEATRAGAVVIGEDLGTVEPGVRETLQRRGVLGTSVLWFERDWEGDGRPLPPERW
RADCLATATTHDLPPTAARLTGDHVELRDRLGLLTRSAAEERAEAAADAAEWLALLGSLG
LLDSPAAGPPGSDEEEEIRAVHRFLLRTPARLVGVWLPDGVGDRRPQNLPGTWDQYPNWR
LPVADADGRPVPLEELVASPRLRALLEVLR
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgcccgacgagcaccccaccgaggacctcgcccggctggccgggctgcac
ggggtcgacacgtcctaccgccccgccccggaccgtaccgtccaggtccccgcctccgcc
gtgaccgccgccctcgccgccctcggcgtcgacgcggccggcccggacgccgtacgcgcc
gccctcgccgcccgggaacgcgagctgcgcgagcgcctgctgccgccgacggtggtccag
tgggccggcgcggaaccgcccgccgccctcaccgcgctgcccgccggcacccggctgcgc
gtcgagaccgaggacggggcggaacgggacggcgccggggatctgccgctcggcgtccac
cggctgaccgccaccgcgcccgacgggcggaccggtgaggcgtgcctcgtcatcgccccg
gaccggctgcccgccccgcccggccgctcctacggcctgctcgtccagctctactccctg
ctctcccgccgctcctggggcatgggcgacctcgccgacctcgccgagctggccggctgg
gccggacgcaccgccggtgccgggttcgtccaggtgaacccgctgcacgcggccgtaccg
ggcgcccccaccgacccttccccgtaccgcccctcctcccgccgcttccccgaccccgtc
cacctgcgggtcgaggacgtccccgagtacgcgtacgccgaggaccgcgagcggctggac
gggctgctggagcgggccgggcggctgcgcgccgccgtcctggacaagggcgccctcatc
gaccgggacgcggtgtgggagctgaagcgccaggcgctggaactggtcgcgcgggtcccc
ctcgggcccggccgccaggccgcctacgacgccttccgcgccgcccacggccgggccctg
gacgaccatgccacctggtgcgccctcgccgaggtccacggctccgactggcaccgctgg
ccggacgggctgcgcgacccccgctcggccgccaccgcccgggcgcgggaggagctcgcc
gaccgggtggagttccacacccgtctcgcctggctcaccgacggccagctccgcgccgcc
cagcgtgccgcccgcgaggccggcatgccggtcgggatcgtgcacgacctggccgtcggc
gtgcacccggcgggcgccgacgcctgggcccagcaggacgtgttcgccgccgggatgtcc
gtcggcgccccgccggacgccttcaacgcgcgcggccaggactggggattgccgccctgg
cgccccgaccggctcgccgcgaccggccacgccccctaccgcgatctcctgcgcgccctg
ttccgctacgccggggcgctgcgcatcgaccacgtcatgggcctgttccggctctggtgg
gtcccccagggcagcccgcccaccgacggcacctacgtccgctacgacgccgacgccatg
ctcgcgatcctggccctggaggcgacccgcgcgggtgccgtcgtgatcggcgaggacctc
ggcaccgtcgaacccggcgtgcgcgagacgctccagcggcgcggggtgctcggcacctcc
gtgctctggttcgaacgggactgggagggcgacggccgcccgctgccgcccgagcgctgg
cgcgccgactgcctggccaccgccaccacccacgacctgccgcccaccgccgcccggctc
accggcgaccacgtcgaactgcgcgaccgcctcggcctgctgacccgttcggccgccgag
gaacgcgcggaggccgccgccgacgccgcggagtggctcgccctgctcggcagcctcggt
ctgctggacagcccggcggccggaccacccggctccgacgaggaggaggagatccgcgcc
gtccaccgcttcctgctgcgcacccccgcccggctggtcggggtctggctcccggacggc
gtcggcgaccggcgcccgcagaacctgccgggcacctgggaccagtacccgaactggcgg
ctgccggtcgccgacgccgacggccgcccggtgccgctggaggaactggtcgcctcgccc
cggctcagggccctgctggaggtgctgcgctga

DBGET integrated database retrieval system