KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_4193Help
Entry
SHJGH_4193        CDS       T02531                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHJGH_4193
Enzymes [BR:sho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SHJGH_4193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4784152..4785303
Genome map
AA seq 383 aa AA seqDB search
MYDEEQHPEHGPLAGFTVGVTAARRAEELGALLQRRGATVVHAPALRIVPLADDGELLAA
TKELIDQVPDVVVATTAIGFRGWVEAADGWGLGEQLLGRLRGVRLLARGPKVKGAIRAAG
LTEEWSPSSESLAEVLDRLLEEGVEGDRVAVQLHGEPLPGFVESLRAAGAEVVPVPVYRW
MPPEDLSPLDRLLDAAVTRGVDALTFTSAPAAASLLSRAEDRGLLDDLLAALAHDVLPAC
VGPVTAIPLQARGVDTVQPERFRLGPLVQLLCQELPARARSLPIAGHRVEIRGHAVLVDG
DLKPVPPAGMSLLRALARRPGWVVPRADLLRALPGAGRDEHAVETAMARLRTALGTPKLI
QTVVKRGYRLALDPAADAKYADA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgaagagcagcaccccgagcacggccccctcgccgggttcaccgtgggcgtc
accgccgcgcgccgggccgaggaactgggcgccctgctccagcggcgcggcgccaccgtt
gtgcacgcccccgccctgcggatcgtgccgctcgcggacgacggcgaactgctcgccgcc
acgaaggagctcatcgaccaggtgccggacgtcgtggtcgccaccacggcgatcggcttc
cgcggctgggtcgaggccgccgacggctggggcctgggcgaacagctgctgggccggctg
cgcggggtccgcctgctggcccgcgggcccaaggtgaagggcgcgatccgcgcggcgggg
ctcaccgaggaatggtcgccctcctcggaatccctggccgaggtactcgaccgcctcctg
gaggagggcgtcgagggcgaccgcgtcgccgtacaactccacggcgagcccctccccggc
ttcgtggagtcgctgcgggccgccggggcggaagtggtgcccgtcccggtctaccgctgg
atgccccccgaggacctcagccccctcgaccgcctcctggacgcggccgtcacccgtggc
gtggacgccctcaccttcaccagcgcccccgccgcggcctccctcctgtcccgcgcggag
gaccgcggcctgctggacgacctgctggccgccctggcccacgacgtcctcccggcctgt
gtcggcccggtcaccgcgatccccctccaggcccgcggagtggacacggtccagcccgaa
cgcttccgcctcggcccgctggtccagctcctgtgccaggaactcccggcccgcgcccgc
tccctgcccattgccggacaccgggtggagatccgcggccacgcggtcctggtcgacggc
gacctcaagccggtccccccggccggcatgtccctcctgcgcgccctggcccgccgcccc
ggctgggtcgtcccccgcgccgacctcctgcgcgcgctgccgggcgcgggccgcgacgag
cacgccgtcgagacggcgatggcccgcctccgcacggccctcggcaccccgaagctgatc
cagacggtggtgaagcggggctaccgcctggccctggacccggcggcggacgcgaagtac
gcggacgcgtga

DBGET integrated database retrieval system