KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_4362Help
Entry
SHJGH_4362        CDS       T02531                                 

Definition
fatty acid desaturase (membrane)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SHJGH_4362
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SHJGH_4362
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SHJGH_4362
Lipid biosynthesis proteins [BR:sho01004]
 Desaturase
  First
   SHJGH_4362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4997262..4998269
Genome map
AA seq 335 aa AA seqDB search
MTSSSDVIDEARKATDTPPPSATLGGEQKRSIEQITLLLFITVPFLALVAAVPLAWGWGV
SWLDLGLLVFFYFLGCHGITIGFHRYFTHGSFKAKRPLRIALAIMGSLAVEGPLVRWVAD
HRKHHKFSDAEGDPHSPWRFGETLPALMKGLWWAHIGWMFDEEQTPQDKYAPDLIKDPAM
RAISRQFVLWTAVSLGLPPLIGGLATMSWWGAFTGFFWGSLVRVALLHHVTWSINSICHA
VGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVMRGQIDSSARFIRIFELL
GWAYDVRWPSRSRIDSRRHTGEGGSRRRGETAEAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaagttccgatgtgatcgacgaagcccgtaaggccaccgacacaccccctccc
tccgccacgctgggcggcgagcagaagcgttcgatcgagcagatcacgctgctcctgttc
atcaccgtgccgttcctggcactggtggcggccgtgccgctggcctggggctggggggtg
agctggctcgatctgggcctgctggtcttcttctacttcctgggctgccacggcatcacg
atcggtttccaccggtacttcacccacggttcgttcaaggcgaagcggcccctgcggatc
gcgctcgcgatcatgggttcgctggcggtcgaggggccgctggtgcgctgggtggccgat
caccgcaagcaccacaagttctccgacgcggagggcgacccgcactccccgtggcggttc
ggcgagacgctcccggcgctgatgaagggcctgtggtgggcgcacatcggctggatgttc
gacgaggagcagaccccgcaggacaagtacgcgccggatctgatcaaggacccggcgatg
cgggcgatctcccggcagttcgtgctgtggacggccgtgtccctggggctgccgccgctg
atcggcggtctggcgacgatgtcctggtggggcgcgttcaccgggttcttctggggttca
ctcgtccgggtggcgctgctgcaccatgtgacgtggtcgatcaactcgatctgccacgcg
gtcggcaagcggccgttcaagtcgcgggaccgttcgggcaacgtgtggtggctggcggtg
ctgtcctgcggtgagtcctggcacaacctgcaccacgccgacccgacgtcggcgcggcac
ggtgtgatgcgcggccagatcgactcctcggcccgcttcatccgcatcttcgagctgctc
ggctgggcgtacgacgtgcgctggccgtcacgctcgcgtatcgattcgcggcgtcacacc
ggggaaggcggctcccggcgccggggggagacggccgaggcggcatga

DBGET integrated database retrieval system