KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_4834Help
Entry
SHJGH_4834        CDS       T02531                                 

Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJGH_4834
  Energy metabolism
   00680 Methane metabolism
    SHJGH_4834
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHJGH_4834
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     SHJGH_4834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5505454..5506590)
Genome map
AA seq 378 aa AA seqDB search
MKDVPDAKIEHPCDIIVRITTTNICGSDLHMYEGRTSFESGRTLGHENLGQVVEVGPAVR
KVQVGEYVVLPFNIACGFCKQCEQGLTNYCLTMQPEPALAGAAYGFADMGPYQGGQAELL
RVPYGDFNALRLGEDAAERQTDYVMLADIFPTGYHATEMAHVKPGDQTVVFGAGPVGLMA
TYSALLKGAGRVWTVDHQPDRLRKAEEIGAIPINTAEQDPAEVVKEATLGLGADNGCECV
GYQAHDPQGHEDASLTLNGLIDSVRFTGDIGVVGVFLPQDPGGAEAQGELEAQGKVPIDF
GLMWFKGQHMGTGQAPVKKYNRALRDLIAGGKAKPSFVVSHELSLDEAPTAYEHFDARDE
GWTKVVLHPDGHGNGHKK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacgtaccggacgcgaagatcgaacacccctgcgacatcatcgtcaggatcacc
accaccaacatctgcggttcggacctgcacatgtacgagggccgcacctcgttcgagtcc
ggccgcaccctgggacacgagaacctgggccaggtggtggaggtcggcccggccgtccgc
aaggtccaggtcggcgagtacgtggtcctgcccttcaacatcgcctgcggcttctgcaag
cagtgcgagcagggcctgaccaactactgcctgaccatgcagccggaaccggccctcgcc
ggagccgcctacggattcgccgacatgggcccctaccagggcggccaggcggaactgctg
cgcgtgccctacggcgacttcaacgcgctgcgtctgggcgaggacgccgccgagcggcag
accgactacgtgatgctcgccgacatctttcccaccggctatcacgccaccgagatggcc
cacgtcaagccgggcgaccagaccgtcgtcttcggggccggtcccgtcgggctgatggcg
acctactccgccctcctcaagggcgccggccgcgtctggacggtcgaccaccagcccgac
cggctgcgcaaggcggaggagatcggggccatcccgatcaacaccgccgagcaggacccc
gcggaggtcgtcaaggaggccaccctcggtctgggcgccgacaacggctgcgagtgcgtc
ggctaccaggcacacgatccccagggacacgaggacgccagcctcacgctcaacggcctg
atcgactcggtccggttcacgggcgacatcggcgtggtgggcgtgttcctgccccaggac
cccggcggcgcggaagcccagggggagctggaggcgcagggcaaggtcccgatcgacttc
ggcttgatgtggttcaagggccagcacatggggaccgggcaggcgccggtgaagaagtac
aaccgggcgctgcgggacctgatcgccggcgggaaggcgaagccgagcttcgtcgtctcc
cacgagctcagcctggacgaggcccccaccgcctacgagcacttcgacgcccgtgacgag
ggctggaccaaggtggtcctgcaccccgacggacatggcaacggccacaaaaagtaa

DBGET integrated database retrieval system