KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_4834Help
Entry
SHJGH_4834        CDS       T02531                                 

Definition
(RefSeq) glutathione-independent formaldehyde dehydrogenase
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(5505454..5506590)
Genome map
AA seq 378 aa AA seqDB search
MKDVPDAKIEHPCDIIVRITTTNICGSDLHMYEGRTSFESGRTLGHENLGQVVEVGPAVR
KVQVGEYVVLPFNIACGFCKQCEQGLTNYCLTMQPEPALAGAAYGFADMGPYQGGQAELL
RVPYGDFNALRLGEDAAERQTDYVMLADIFPTGYHATEMAHVKPGDQTVVFGAGPVGLMA
TYSALLKGAGRVWTVDHQPDRLRKAEEIGAIPINTAEQDPAEVVKEATLGLGADNGCECV
GYQAHDPQGHEDASLTLNGLIDSVRFTGDIGVVGVFLPQDPGGAEAQGELEAQGKVPIDF
GLMWFKGQHMGTGQAPVKKYNRALRDLIAGGKAKPSFVVSHELSLDEAPTAYEHFDARDE
GWTKVVLHPDGHGNGHKK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacgtaccggacgcgaagatcgaacacccctgcgacatcatcgtcaggatcacc
accaccaacatctgcggttcggacctgcacatgtacgagggccgcacctcgttcgagtcc
ggccgcaccctgggacacgagaacctgggccaggtggtggaggtcggcccggccgtccgc
aaggtccaggtcggcgagtacgtggtcctgcccttcaacatcgcctgcggcttctgcaag
cagtgcgagcagggcctgaccaactactgcctgaccatgcagccggaaccggccctcgcc
ggagccgcctacggattcgccgacatgggcccctaccagggcggccaggcggaactgctg
cgcgtgccctacggcgacttcaacgcgctgcgtctgggcgaggacgccgccgagcggcag
accgactacgtgatgctcgccgacatctttcccaccggctatcacgccaccgagatggcc
cacgtcaagccgggcgaccagaccgtcgtcttcggggccggtcccgtcgggctgatggcg
acctactccgccctcctcaagggcgccggccgcgtctggacggtcgaccaccagcccgac
cggctgcgcaaggcggaggagatcggggccatcccgatcaacaccgccgagcaggacccc
gcggaggtcgtcaaggaggccaccctcggtctgggcgccgacaacggctgcgagtgcgtc
ggctaccaggcacacgatccccagggacacgaggacgccagcctcacgctcaacggcctg
atcgactcggtccggttcacgggcgacatcggcgtggtgggcgtgttcctgccccaggac
cccggcggcgcggaagcccagggggagctggaggcgcagggcaaggtcccgatcgacttc
ggcttgatgtggttcaagggccagcacatggggaccgggcaggcgccggtgaagaagtac
aaccgggcgctgcgggacctgatcgccggcgggaaggcgaagccgagcttcgtcgtctcc
cacgagctcagcctggacgaggcccccaccgcctacgagcacttcgacgcccgtgacgag
ggctggaccaaggtggtcctgcaccccgacggacatggcaacggccacaaaaagtaa

DBGET integrated database retrieval system