KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5297Help
Entry
SHJGH_5297        CDS       T02531                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SHJGH_5297
Enzymes [BR:sho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SHJGH_5297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6017716..6018321
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGEGPIGEFDEKRAENAVRELLIAVGEDPDREGLRETPARVARAYREIFAGLW
QQPEDVLTTTFDLGHDEMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPSETGKITGLSKLA
RLVDVYARRPQVQERLTTQIADSLMNILEPRGVIVVVECEHMCMSMRGIRKPGAKTITSA
VRGQLRDAATRNEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctggacggcgagggccccatcggcgagttcgacgagaagcgc
gccgagaacgccgttcgcgaactgctgatcgcggtcggcgaggacccggaccgcgagggc
ctgcgggagacgccggccagggtcgcgcgtgcctacagggagatcttcgccggtctgtgg
cagcagcccgaggacgtcctgacgacgacgttcgacctggggcacgacgagatggtcctg
gtgaaggacatcgaggtgtactcgacctgcgagcatcatctggtgccgttccggggtgtc
gctcacgtcggctacatcccgtccgagaccggcaagatcaccggcctgtccaagctggcc
cgcctggtcgacgtctacgcccgccggccgcaggtgcaggagcgcctcaccacgcagatc
gcggactccctgatgaacatcctggagccgcggggcgtcatcgtggtcgtcgagtgcgag
cacatgtgcatgtccatgcggggcatccgcaagccgggcgcgaagaccataacgtccgcg
gtccgcggtcagctgcgggacgcggcgacgcggaacgaggcgatgagcctcatcatggcg
cgctga

DBGET integrated database retrieval system