KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5771Help
Entry
SHJGH_5771        CDS       T02531                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SHJGH_5771
Enzymes [BR:sho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SHJGH_5771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6546354..6547637
Genome map
AA seq 427 aa AA seqDB search
MAMDAISVIRTKRDRGELTDEQIDWVIDAYTRGEVADEQMSALAMAILLNGMNRREIARW
TAAMIASGERMDFSSLSRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTG
GTLDKLESIPGWRALLSNEEMLNVLDTTGAVICAAGDGLAPADKKLYALRDVTGTVEAIP
LIASSIMSKKIAEGTGSLVLDVKVGTGAFMKTIEDARELASTMVGLGTDHGVKTVALLTD
MSTPLGLTAGNALEVRESVEVLAGGGPADVVELTIALAREMLDAAGIKDADPAKALADGS
AMDVWRRMIAAQGGDPDAPLPTAKEQHVVKAPAPGVLTRLDAYDIGVGAWRLGAGRARKE
DPVQAGAGIELHAKPGDTVTEGQPLLTLHTDTPERFEYALQAVEGCYDIAAPGTAFQATP
VVRERIA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccatggacgccatctccgtcatccgcaccaagcgggaccgcggtgagctgaccgac
gagcagatcgactgggtcatcgacgcgtacacccggggcgaggtcgccgacgagcagatg
tccgcgctcgccatggcgatcctgctgaacggcatgaaccgccgcgagatcgcccgctgg
accgcggccatgatcgcctccggcgagcgcatggacttctcctcgctgtcccgcccgacg
gccgacaagcactccacgggcggcgtcggcgacaagatcaccctgccgctggccccgctc
gtcgccgcctgcggcgcggccgtcccgcagctctccggccggggcctcggccacaccggc
ggcaccctggacaagctggagtcgatccccggctggcgcgcgctgctctccaacgaggag
atgctgaacgtcctggacaccacgggcgcggtgatctgcgcggcgggcgacggcctggcc
cccgccgacaagaagctctacgccctgcgcgacgtcaccggcacggtcgaggcgatcccc
ctgatcgcctcctcgatcatgtcgaagaagatcgccgagggcaccggctccctggtgctg
gacgtgaaggtgggcaccggcgccttcatgaagacgatcgaggacgcccgcgagctggcc
tccacgatggtcggcctcggcaccgaccacggcgtgaagacggtcgcgctgctgacggac
atgtccaccccgctcggcctcacggcgggcaacgccctggaggtccgcgaatcggtcgag
gtcctggcgggcggcggccccgcggacgtcgtggaactgaccatcgccctggcccgcgag
atgctcgacgcggcgggcatcaaggacgccgaccccgcgaaggccctcgccgacggctcg
gcgatggacgtctggcgccggatgatcgcggcgcagggcggcgacccggacgcgccgctg
cccaccgcgaaggagcagcacgtcgtcaaggccccggcccccggcgtcctgacccgcctc
gacgcgtacgacatcggcgtcggcgcctggcgcctgggcgccggccgggcccgcaaggag
gacccggtgcaggcgggcgcgggcatcgagctgcacgccaagccgggcgacacggtgacc
gagggccagcccctgctgaccctgcacaccgacaccccggagcgcttcgagtacgcgctc
caggcggttgagggctgctacgacatcgcggccccgggtacggccttccaggccacgccg
gtggtgcgggaacgcatcgcctga

DBGET integrated database retrieval system