KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_6278Help
Entry
SHJGH_6278        CDS       T02531                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SHJGH_6278
Enzymes [BR:sho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SHJGH_6278
Exosome [BR:sho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHJGH_6278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7109308..7111686)
Genome map
AA seq 792 aa AA seqDB search
MTPKGHKESKAKKEAAARRKTAARKPPAQEVPAQAPPAADVPPRAPAPPAPVPAQAAVPR
AEVAVSPAVDAGDRARLLHGTHHDPHSVLGAHPVPGGVAFRAFRPYARAVTVVSGELRAE
LHDDGDGFFSALLPLTEVPVYRLLVTYDGAVHETEDAYRFLPTLGELDLHLIGEGRHEQL
WQALGAHVTTHQGVAGTRFAVWAPNARGVRVTGGFNFWDGTGFPMRSLGGTGVWELFVPG
IGDGELYKFEITRPDGSRTLRADPLARRTEVPPATSSIVHASHHEWGDAEWLAHRADTPV
HEAPFSVYEVHLPSWRPGLTYRRLAEQLPAYVKEMGFTHVELMPVAEHPFGGSWGYQVTG
FYAPTARLGTPDDFKYLVDKLHQAGIGVLMDWVPAHFPRDEWALAEFDGRPLYEHHDPLR
AAHPDWGTLEFDFGRREVRNFLVANAVYWCEEFHIDGLRVDAVASMLYLDYSREPGQWTP
NEHGGRENLDAVAFLQEMNATVYRRCPGVVTVAEESTAWDGVTRPTHHKGPSGFGGLGFG
MKWNMGWMHDSLQYMSHDPVHRAYHHHEMTFSMVYAYSENYVLPISHDEVVHGKRSLVSK
MPGDWWQQRANLRAYLGFMWAHPGKQLLFMGQEFAQGVEWSEAHGPDWWLLDPAYGAEAD
HRGVRDLVRDLNGVYRATPALWQRDTDPAGFEWITGDAADDNVFAFLRRDAEGTPLLAVS
HLAPVVRHDYRLGVPEEVPAWVEVLNTDAARYGGGDLTHPDVVKPEPQPWHGRPASIRLT
LPPLATVWLRPA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccaagggacacaaggaatccaaggccaagaaggaagcagcggccaggaggaag
accgccgcccggaagccgccggcgcaggaggtccccgcacaggcgccgcccgccgctgac
gtcccgccgcgggcaccggcgccccccgcgccggtccccgcgcaggcggcggtcccccgt
gcggaggtcgccgtgtccccggccgtcgacgccggggaccgcgcacggctgctgcacggc
acccatcatgatccgcactccgtgctgggcgcgcacccggtgccgggcggggtcgccttc
cgcgcgttccgcccgtacgcgcgggcggtcaccgtggtctcgggcgagctgcgggcggag
ctgcacgacgacggcgacggcttcttctccgccctgctcccgctcaccgaggtccccgtc
taccggctgctggtgacgtacgacggcgcggtgcacgagaccgaggacgcctaccgcttc
ctgcccaccctcggcgagctggacctgcacctgatcggcgagggccggcacgaacagctc
tggcaggcgctcggcgcgcacgtcaccacccaccagggcgtcgccggcacccggttcgcg
gtgtgggcgccgaacgcgcggggcgtgcgggtcacgggcgggttcaacttctgggacggc
accggtttcccgatgcgctcgctcggcggcaccggggtctgggagctgttcgtgccgggg
atcggcgacggcgagctgtacaagttcgagatcacccgcccggacggctcgcgcaccctg
cgcgccgacccgctggcccgccgtaccgaggtcccgcccgccacctcctcgatcgtgcac
gcctcgcaccacgagtggggtgacgcggagtggctggcgcaccgggcggacaccccggtg
cacgaggcccccttctcggtctacgaggtgcacctgccgtcctggcggccggggctgacg
taccgccggctggccgagcagctcccggcctacgtcaaggagatgggcttcacccacgtc
gagctgatgccggtcgccgagcaccccttcggcggctcctggggctaccaggtcaccggg
ttctacgcgccgacggcccggctcggcacccccgacgacttcaagtacctggtggacaag
ctgcaccaggcgggcatcggggtgctgatggactgggtgccggcgcacttcccgcgcgac
gagtgggcgctcgcggagttcgacgggcgcccgctgtacgagcaccacgacccgctgcgg
gccgcccatcccgactggggcacgctggagttcgacttcggccggcgcgaggtgcgcaac
ttcctcgtcgcgaacgccgtgtactggtgcgaggagttccacatcgacgggctgcgcgtg
gacgccgtcgcctcgatgctctacctggactactcgcgcgagccgggccagtggacgccg
aacgagcacggcggccgggagaacctggacgcggtggccttcctccaggagatgaacgcc
accgtgtaccggcgctgcccgggcgtggtgaccgtcgccgaggagtccacggcctgggac
ggcgtcacccggcccacccaccacaaggggccgagcggcttcggcgggctgggtttcggc
atgaagtggaacatgggctggatgcacgactcgctccagtacatgagccacgatcccgtg
caccgcgcctaccaccaccacgagatgacgttctcgatggtgtacgcgtacagcgagaac
tacgtcctgccgatctcccacgacgaggtcgtccacggcaagcggtccctggtgtcgaag
atgcccggcgactggtggcagcaacgcgccaacctgcgcgcctacctgggcttcatgtgg
gcccaccccggcaagcagctcctcttcatggggcaggagttcgcccagggcgtcgagtgg
tccgaggcgcacggccccgactggtggctgctggacccggcgtacggcgccgaggcggac
caccggggtgtgcgggacctcgtccgggacctgaacggggtgtaccgggcgaccccggcg
ctgtggcagcgggacaccgacccggcgggcttcgagtggatcacgggggacgcggcggac
gacaacgtcttcgcgttcctgcgccgcgacgccgagggcaccccgctgctcgcggtctcc
cacctggctccggtggtccgccacgactaccgcctcggggtgccggaggaggtgccggcc
tgggtggaggtcctcaacaccgacgcggcccgctacggcggcggcgacctcacccacccg
gacgtcgtcaagcccgagccccagccctggcacggccgcccggcgagcatccggctgacc
ctgcccccgctggcgacggtgtggctgcgcccggcctga

DBGET integrated database retrieval system