KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_6397Help
Entry
SHJGH_6397        CDS       T02531                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SHJGH_6397
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SHJGH_6397
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SHJGH_6397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7241704..7243503)
Genome map
AA seq 599 aa AA seqDB search
MAVPPAHAAGEQVTAWLTTTDDSAGRHVVRGLQPQTPFAFQSGTGGSGENITVDENTRYQ
TFTGGGASFTDTAAWLMNSSGALSQATRDATMRKLFSPTDGIGLSFLRNPMGASDLARYG
YTYDDVPAGQTDPSLAKFSIAHDLADVVPLTRQALQLNPSLTVMASPWTAPAWMKDSGSL
NGGWLKSEDYGAYASYFVKYLQAYKDQGVNVSYVTAQNEPTCCSGYPSMSWNASGLAYFT
KNELLPKLQAAGLTTKVLAHDWNWDVYDSYAAQTVDDPAVRNHPNFGGIAWHGYGGDIAK
QTTVHNQYPALDAFGTEHSGGTWIADQQREDMSNIIDYTRNWAKSVTKWSLAVDQNMGPH
NGGCGTCTGLITVHNGDGASGTVDYTVEYYDMGHLTKFVRPGAQRIASTASTTVPNVAWR
NPDGSKALIAYNDSSSARTVTINWGPQHATYSLPGNTSATFTWSGTQSGGGARTGAFVGL
AGKCLDVAGGSSANGTAVQLYDCNGSAAQQWTVQADGSIQALGKCLDVSSASTADGAKVQ
LYDCNGTGAQRWSYNAATSDVVNTAANKCLDVTDNSSANGARAQIWSCTGAANQKWTLR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtaccccccgcgcacgcggccggtgagcaggtgaccgcctggctcaccaccacc
gacgactccgccggccggcacgtcgtacgcggcctccagccgcagaccccgttcgccttc
cagtccgggacgggcgggagcggcgagaacatcaccgtcgacgagaacacccgctaccag
accttcaccggcggcggcgcgtccttcacggacaccgccgcctggctgatgaacagcagc
ggggcgctgtcccaggcgacccgggacgcgaccatgcgcaagctgttctcgccgacggac
ggcatcggcctgtcgttcctgcgcaacccgatgggcgcctccgacctcgcccggtacggc
tacacctacgacgacgtgccggccgggcagaccgacccgtccctggcgaagttctccatc
gcgcacgacctggcggacgtcgtcccgctgacccggcaggcgctccagctcaacccgtcc
ctgaccgtgatggcctcgccgtggacggcaccggcctggatgaaggacagcggctcgctc
aacggcggctggctgaagtccgaggactacggggcgtacgcctcctacttcgtgaagtac
ctccaggcgtacaaggaccagggcgtcaacgtctcctacgtcaccgcgcagaacgagccg
acctgctgttccggctacccgtcgatgagctggaacgccagcggactcgcctacttcacc
aagaacgaactgctgcccaagctccaggcggcggggctgaccaccaaggtgctggcgcac
gactggaactgggacgtctacgactcctacgcggcccagaccgtggacgacccggccgtc
cgcaaccatcccaacttcggcggcatcgcctggcacggctacggcggtgacatcgccaag
cagacgaccgtgcacaaccagtaccccgcgctggacgccttcggcaccgagcactccggc
ggcacctggatcgccgaccagcagcgcgaggacatgtccaacatcatcgactacacccgc
aactgggcgaagtcggtgaccaagtggtcgctggccgtggaccagaacatgggcccgcac
aacggcggctgcggcacctgcaccggtctgatcaccgtgcacaacggcgacggcgcgagc
gggaccgtggactacaccgtcgagtactacgacatgggccacctgaccaagttcgtccgc
cccggcgcccagcgcatagcctccaccgcctccaccacggtgccgaacgtcgcctggcgc
aacccggacggcagcaaggcgctgatcgcgtacaacgactcctcgtcggcccggaccgtg
accatcaactggggtccccagcacgccacttactcgctgcccggcaacacctcggccacc
ttcacctggtccggcacccagtccggcggcggcgccaggaccggggccttcgtcggcctc
gccggcaagtgcctggacgtggcgggcggttcgagcgccaacggcacggcggtgcagctc
tacgactgcaacggcagcgcggcccagcagtggaccgtccaggccgacggatcgatccag
gcgctcggcaagtgcctggacgtgagctccgcttcgacggcggacggggccaaggtgcag
ttgtacgactgcaacggaaccggtgcccaacggtggtcgtacaacgccgccacgagtgat
gtggtgaacacggcggcgaacaagtgcctcgacgtcaccgacaactcgtcggcgaacggg
gcccgggcccagatctggtcgtgcaccggcgccgccaaccagaagtggaccctgcggtga

DBGET integrated database retrieval system