KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_6861Help
Entry
SHJGH_6861        CDS       T02531                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHJGH_6861
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SHJGH_6861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7805468..7806823
Genome map
AA seq 451 aa AA seqDB search
MTVLEAGDRVGGKLLPGEIAGVRVDLGAESMLARRPEAVALAREAGLGELLQPPATATAS
IWTRGALRPMPKGHVMGVPGTAAALAGVLSDEGLARIERDADLPRTEVGDDVAVGEYVAA
RLGREVVDRLVEPLLGGVYAGDAYRISMRSAVPQLFQAARTHASLTEGVREIQVKAAAQQ
QTGPVFMGIAGGVGRLPQAVADSVRARGGEILTGTPARELRREAAGGWRITAGERVLRAD
AVIVAVPAPAAAALLRAESPGAAAELDAVEYASMALITLAYRHADLNLPAGSGFLVPPVD
GRTIKASTFASQKWGWIAEEDPDVVVLRTSVGRHGETEVLGRDDADLVEVSRHDLREATG
LAAAPLRTRVTRWTDGLPQYPVGHHARVARVREQIAKLPGLAVCGAQYDGVGIPACIASA
YAAVDQLGGDLTGVRELTANPVQSLHGGAGE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgctggaggccggcgaccgggtcggcggcaagctgttgcccggcgagatcgcc
ggcgtgcgcgtcgacctgggcgccgagtccatgctcgcccgccgccccgaagcggtggcc
ctcgcgcgcgaggccggactcggcgagctgctccagccgcccgccaccgcgaccgcctcg
atctggacccggggcgccctgcggcccatgcccaagggccatgtgatgggcgtgcccggc
accgccgccgccctggccggcgtcctgtcggacgagggcctggcccgcatcgagcgcgac
gccgacctgccccgcaccgaggtcggcgacgacgtggccgtgggggagtacgtggcggcc
cggctcggccgcgaagtcgtcgaccggctcgtcgaacccctgctcggcggggtgtacgcg
ggcgacgcctaccgcatctcgatgcgctccgccgtcccccagctcttccaggccgcccgc
acccacgcctccctcacggagggcgtccgggagatccaggtgaaggccgccgcccagcag
cagaccgggccggtcttcatgggcatcgccggtggggtcggccggctgccgcaggcggtc
gccgactcggtgcgcgcgcggggcggcgagatcctgaccggcacgcccgcgcgtgaactg
cgccgcgaggcggccggcggctggcggatcaccgccggggagcgcgtgctgcgcgccgac
gccgtgatcgtcgccgtacccgccccggccgccgccgccctgctgcgcgccgagtccccg
ggggccgccgccgagctggacgccgtcgagtacgcctcgatggccctgatcaccctcgcc
taccggcacgccgacctgaacctgcccgcgggcagcggcttcctggtgccgcccgtcgac
ggccgcaccatcaaggcctccaccttcgcctcccagaagtggggctggatcgccgaggag
gacccggacgtggtcgtcctgcgcacgtccgtgggccgccacggcgagacggaggtcctc
ggccgggacgacgccgacctggtggaggtctcccggcacgacctgcgggaggccaccggc
ctggccgccgcacccctgcggacccgggtcacccgctggaccgacggcctgccgcagtac
ccggtcgggcaccacgcgcgcgtggcccgcgtccgcgagcagatcgccaagctgccgggg
ctcgcggtgtgcggcgcgcagtacgacggcgtcggcatcccggcctgcatcgcgagcgcg
tacgcggcggtggaccagctcggcggcgacctcaccggggtccgggagctcacggccaac
ccggtgcagagcctgcacggcggagcgggagaatag

DBGET integrated database retrieval system