KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7042Help
Entry
SHJGH_7042        CDS       T02531                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00220  Arginine biosynthesis
sho00250  Alanine, aspartate and glutamate metabolism
sho00290  Valine, leucine and isoleucine biosynthesis
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
sho01130  Biosynthesis of antibiotics
sho01210  2-Oxocarboxylic acid metabolism
sho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJGH_7042
   00290 Valine, leucine and isoleucine biosynthesis
    SHJGH_7042
   00220 Arginine biosynthesis
    SHJGH_7042
Enzymes [BR:sho01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SHJGH_7042
    2.6.1.66  valine---pyruvate transaminase
     SHJGH_7042
Amino acid related enzymes [BR:sho01007]
 Aminotransferase (transaminase)
  Class I
   SHJGH_7042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGF66704
Position
complement(8002647..8003855)
Genome map
AA seq 402 aa AA seqDB search
MEFRQSNKLSEVCYEIRGPVIEHANALEEAGHSVLRLNTGNPAAFGFEAPEEILQDMIRM
LPRAHGYTDSRGVLSARRAVAQRYQALGLDVDVDDVYLGNGVSELVSMAVQALIEDGDEV
LVPAPDFPLWTAVTTLAGGKAVHYLCDEQADWNPDLADMASKITDRTKAVVIINPNNPTG
AVYPKEVVEGILDLARRHGLMVFADEIYDQILYDDAVHHSAAALAPDLVVLTFCGLSKTY
RVAGFRSGWLVVTGPKQHAKDYLEGLTMLASMRLCANAPAQYAIQAALGGRQSIGELTVP
GGRLYEQRNVAWEKLNEIPGVSCVKPKGALYAFPRIDPKVHPIHDDEKFVLDLLLREKIQ
VVQGTGFNWPSPDHFRILTLPHADDLEAAIGRIGRFLSGYRQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtccaacaagctcagcgaggtgtgctacgagatccgcggcccggtg
atcgagcacgccaacgcgctggaggaggcggggcacagcgtgctgcgcctgaacaccggc
aatcccgcggccttcggcttcgaggcgccggaggagatcctccaggacatgatccggatg
ctgccgcgggcccacggctacacggactcccgcggagtcctctccgcccgccgcgcggtc
gcccagcgctaccaggccctgggcctcgacgtggacgtggacgacgtctacctgggcaac
ggcgtctcggagctggtctccatggccgtacaggcgctgatcgaggacggcgacgaagtc
ctcgtccccgcgccggacttccccctgtggaccgccgtcaccacgctggccggcggcaag
gccgtgcactacctgtgcgacgaacaggccgactggaacccggacctggccgacatggcg
tcgaagatcaccgaccgcaccaaggccgtggtcatcatcaacccgaacaacccgaccggc
gcggtctaccccaaggaggtcgtcgagggcatcctcgacctggcccgccggcacggcctg
atggtgttcgccgacgagatctacgaccagatcctctacgacgacgccgtccaccactcg
gccgcggcgctcgcccccgacctcgtcgtcctcaccttctgcggcctgtccaagacctac
cgggtggcgggcttccgctccggctggctggtggtcaccgggccgaagcagcacgccaag
gactacctggagggcctgaccatgctggcctccatgcggctgtgcgccaacgcgcccgcc
cagtacgccatccaggccgcgctcggcggacgccagtccatcggcgaactcaccgtgccc
ggcgggcggctgtacgagcagcggaacgtggcctgggagaagctcaacgagatcccgggc
gtgtcctgcgtcaaacccaagggcgcgctgtacgcgttcccgcgcatcgatcccaaggtg
cacccgatccacgacgacgagaagttcgtcctggacctgctgctgcgcgagaagatccag
gtggtccagggcaccggcttcaactggccctcccccgaccacttccgcatcctgaccctg
ccgcacgcggacgacctggaggcggcgatcggccggatcggcaggttcctcagcggctac
cggcagtag

DBGET integrated database retrieval system