KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7042Help
Entry
SHJGH_7042        CDS       T02531                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SHJGH_7042
   01230 Biosynthesis of amino acids
    SHJGH_7042
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJGH_7042
   00290 Valine, leucine and isoleucine biosynthesis
    SHJGH_7042
Enzymes [BR:sho01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SHJGH_7042
    2.6.1.66  valine---pyruvate transaminase
     SHJGH_7042
Amino acid related enzymes [BR:sho01007]
 Aminotransferase (transaminase)
  Class I
   SHJGH_7042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8002647..8003855)
Genome map
AA seq 402 aa AA seqDB search
MEFRQSNKLSEVCYEIRGPVIEHANALEEAGHSVLRLNTGNPAAFGFEAPEEILQDMIRM
LPRAHGYTDSRGVLSARRAVAQRYQALGLDVDVDDVYLGNGVSELVSMAVQALIEDGDEV
LVPAPDFPLWTAVTTLAGGKAVHYLCDEQADWNPDLADMASKITDRTKAVVIINPNNPTG
AVYPKEVVEGILDLARRHGLMVFADEIYDQILYDDAVHHSAAALAPDLVVLTFCGLSKTY
RVAGFRSGWLVVTGPKQHAKDYLEGLTMLASMRLCANAPAQYAIQAALGGRQSIGELTVP
GGRLYEQRNVAWEKLNEIPGVSCVKPKGALYAFPRIDPKVHPIHDDEKFVLDLLLREKIQ
VVQGTGFNWPSPDHFRILTLPHADDLEAAIGRIGRFLSGYRQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtccaacaagctcagcgaggtgtgctacgagatccgcggcccggtg
atcgagcacgccaacgcgctggaggaggcggggcacagcgtgctgcgcctgaacaccggc
aatcccgcggccttcggcttcgaggcgccggaggagatcctccaggacatgatccggatg
ctgccgcgggcccacggctacacggactcccgcggagtcctctccgcccgccgcgcggtc
gcccagcgctaccaggccctgggcctcgacgtggacgtggacgacgtctacctgggcaac
ggcgtctcggagctggtctccatggccgtacaggcgctgatcgaggacggcgacgaagtc
ctcgtccccgcgccggacttccccctgtggaccgccgtcaccacgctggccggcggcaag
gccgtgcactacctgtgcgacgaacaggccgactggaacccggacctggccgacatggcg
tcgaagatcaccgaccgcaccaaggccgtggtcatcatcaacccgaacaacccgaccggc
gcggtctaccccaaggaggtcgtcgagggcatcctcgacctggcccgccggcacggcctg
atggtgttcgccgacgagatctacgaccagatcctctacgacgacgccgtccaccactcg
gccgcggcgctcgcccccgacctcgtcgtcctcaccttctgcggcctgtccaagacctac
cgggtggcgggcttccgctccggctggctggtggtcaccgggccgaagcagcacgccaag
gactacctggagggcctgaccatgctggcctccatgcggctgtgcgccaacgcgcccgcc
cagtacgccatccaggccgcgctcggcggacgccagtccatcggcgaactcaccgtgccc
ggcgggcggctgtacgagcagcggaacgtggcctgggagaagctcaacgagatcccgggc
gtgtcctgcgtcaaacccaagggcgcgctgtacgcgttcccgcgcatcgatcccaaggtg
cacccgatccacgacgacgagaagttcgtcctggacctgctgctgcgcgagaagatccag
gtggtccagggcaccggcttcaactggccctcccccgaccacttccgcatcctgaccctg
ccgcacgcggacgacctggaggcggcgatcggccggatcggcaggttcctcagcggctac
cggcagtag

DBGET integrated database retrieval system