KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7371Help
Entry
SHJGH_7371        CDS       T02531                                 

Definition
ATP-dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sho03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:sho03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sho03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:sho03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8357441..8358517)
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMHYEAKWDGFRSIVFRDGAEVELGSRTGKPLTRYFPE
LVEALKERLPERCVLDGEIVIARGGRLDFDALTERIHPAASRVRMLAEKTPASFVAFDVL
ALDDHALLDVPLTDRRALLDRALAGATPPVHVAPSTTDIEVARQWFEQFEGAGLDGVVAK
PLTLRYLQDERAMFKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDEQGRLQHVGVSAA
FSMKKRAELVEELEPLRMDDVSGHPWAAWTDETAHETARLPGAPSRWSGKKDLSWVPLRP
DRVAEVAYDHMENGQRFRHTARFRRWRPDRTPESCTYAQLQEPVRYDLAEILGEKDGG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcccgtcatgccgcccgtgaagccgatgctcgccaagtcggtggcgaagatc
ccgccggggatgcactacgaggccaagtgggacggcttccggtcgatcgtgttccgggac
ggggccgaggtcgaactgggcagccgcaccggaaagccgctgaccaggtacttccccgag
ctggtcgaggcgctgaaggagcggctgcccgagcggtgcgtgctggacggggagatcgtc
atcgcgcggggcggccggctggacttcgacgcgctgaccgagcggatccacccggcggcc
tcccgggtacggatgctggcggagaagaccccggcctccttcgtcgccttcgacgtgctc
gccctggacgaccacgccctgctcgacgtgccgctcaccgaccgccgcgccctgctggac
cgggccctggccggggcgaccccgccggtgcacgtggcgccgtcgacgaccgacatcgag
gtggcccggcagtggttcgagcagttcgaaggcgccggtctcgacggggtcgtcgccaag
ccgctcaccttgcgctacctccaggacgagcgggccatgttcaagatcaagcacgagcgc
acggcggacgtcgtcgtcgccgggtaccgcttccacaaaagcggcccggtggtgggctcg
ctgctgctggggctgtacgacgagcagggccggctccagcacgtgggcgtgtcggccgcg
ttctccatgaagaagcgcgccgagctggtcgaggagctggagccgctgcgcatggacgac
gtctccgggcacccgtgggccgcctggacggacgagaccgcgcacgagacggcccggctg
ccgggcgcgccgagccgctggtcgggcaagaaggacctgtcctgggtgccgctgcggccg
gaccgggtggccgaggtggcgtacgaccacatggagaacggccagcggttccggcacacg
gcccgcttccgccgctggcgcccggaccgcacaccggagagctgcacgtacgcccagctc
caggagccggtccggtacgacctcgcggagatcctcggcgagaaggacggcggctga

DBGET integrated database retrieval system