KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7466Help
Entry
SHJGH_7466        CDS       T02531                                 

Definition
beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Brite
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SHJGH_7466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8454923..8455618)
Genome map
AA seq 231 aa AA seqDB search
MDMEHALTRPMSRRGFINRAGALALATTASGLLLPDTAQAATVITTNQTGTNNGFYYSFW
TDGGGSVSMTLNSGGNYSTSWTNCGNFVAGKGWSNGGRRNVQYSGSFYPSGNGYLALYGW
TSNPLVEYYIVDNWGNYRPTGTYKGTVTSDGGTYDVYQTTRYNAPSVEGTKTFNQYWSVR
QSKRTGGTITTGNHFDAWARYGMQLGSFSYYMILATEGYQSSGSSNLTVSG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggacatggagcacgccctcacccgcccgatgagccgcaggggcttcatcaaccgtgcc
ggcgcgctcgcgctggccaccaccgcgtccgggctgctgctgcccgacaccgctcaggcc
gccacggtcatcaccaccaaccagaccggcaccaacaacgggttctactactccttctgg
accgacggcggcggttcggtctcgatgaccctgaactccggcggcaactacagcacctcg
tggacgaactgcgggaacttcgtcgccggcaagggctggagcaacggcggacgcaggaac
gtgcagtactcgggcagcttctacccgtccggcaacggctacctggcgctgtacgggtgg
acctcgaacccgctcgtcgagtactacatcgtcgacaactggggcaactaccggcccacc
ggaacgtacaagggcacggtcaccagcgacggcggcacgtacgacgtctaccagacgacg
cggtacaacgccccctccgtggaaggcaccaagaccttcaaccagtactggagcgtccgg
cagtccaagcggaccggcggcaccatcaccaccggcaaccacttcgacgcctgggcccgc
tacggcatgcaactgggcagcttcagctactacatgatcctcgccaccgagggctaccag
agcagcggctcctccaacctcacggtgagcggctga

DBGET integrated database retrieval system