KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7467Help
Entry
SHJGH_7467        CDS       T02531                                 

Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8455930..8457015
Genome map
AA seq 361 aa AA seqDB search
MNLPRSLAAVASVCCLTLLPLVAASPASAFGGTGVPDRPLRQLAADDHLRVGTAVDMSAL
ADDAAYRRLAGSEFSTVTPENVMKWEAIEPRQGEYDYAPADRLVDFARKHGQKVRGHVLV
WHSQLPSWLTSGDFSADQLREILHRHITDTVRHFKGRVWQWDVVNEAFNEDGTLRDSIWL
RELGPGYIADAFRWAHEADPHALLFYNDYNTEWTGPKSDAVYELAGRLRAQGVPIDGVGF
QGHLGIQYGLPSGMAANFARFDKLGLATAVTEADVRMPLPADADKLATQAEGYRLLLDAC
LRTRHCISFTVWGFTDTYSWVPGTFPGEGAANLYDEDYRPKPAYRTLQSALAGRARAGGA
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctgccccgctccctcgcggccgtcgcctcggtctgctgcctgaccctgctcccc
ctcgtcgccgcgagccccgcgagcgccttcggcggcaccggcgtaccggaccgtccgctg
cggcagctcgccgccgacgaccacctgcgggtaggcaccgccgtcgacatgtccgcgctc
gccgacgacgccgcctaccgccggctcgcgggctccgagttctccaccgtcaccccggag
aacgtgatgaagtgggaggcgatcgagccccgccagggggagtacgactacgcgcccgcc
gaccgcctggtcgacttcgcgcgcaagcacggccagaaggtgcgcggccatgtcctggtc
tggcacagccagttgccgtcctggctcacctccggcgacttcagcgccgaccagctgcgc
gagatcctgcaccgtcacatcaccgacaccgtccggcacttcaagggcagggtctggcag
tgggacgtggtgaacgaggcgttcaacgaggacggcaccctgcgcgacagcatctggctg
cgcgagctcggtcccggctacatcgccgacgccttccgctgggcccacgaggccgacccg
cacgccctgctgttctacaacgactacaacaccgagtggacgggcccgaagagcgacgcc
gtctacgaactggccggccgcctgcgcgcgcagggcgttcccatcgacggagtcggcttc
caggggcacctcggcatccagtacggcctgccctccgggatggcggccaacttcgcccgc
ttcgacaagctcggactggccaccgccgtcacggaggcggacgtgcgcatgccactgccg
gccgacgcggacaagctcgccacgcaggccgagggctaccggctcctgctcgacgcctgc
ctgcgcacccgccactgcatctcgttcaccgtctggggtttcaccgacacgtactcctgg
gtccccggcacgttccccggcgagggcgccgcgaacctgtacgacgaggactaccgcccg
aagccggcgtaccgcacgctccagtccgcactggcgggccgggcgcgggccgggggtgcc
gagtag

DBGET integrated database retrieval system