KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7623Help
Entry
SHJGH_7623        CDS       T02531                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sho00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SHJGH_7623
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SHJGH_7623
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SHJGH_7623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8645889..8646752
Genome map
AA seq 287 aa AA seqDB search
MPELPEVAALTDFLTEHLVGRRVVRVLPVAISVLKTYDPPVTAVEGAEVTAVRRHGKFLD
VETDGGLHLVAHLARAGWLQWKDRLPDGPPKPGKGPLALRVALETGEGFDLTEAGTQKRL
AVYVVRDPEEVPGIARLGPDPLAGDFDEDRFAALLQGERRQLKGALRDQSLIAGVGNAYS
DEILHAAKMSPFKLAASLTPEETHRLYEALRDTLTEAVERSRGVAAGRLKAEKKGGLRVH
GRTGEACPVCGDTIREVSFSDSSLQYCPTCQTGGKPLADRRLSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaggtagcagcgctgacggacttcctcaccgagcacctggtcgga
cggcgggtggtgcgggtgctgcccgtggccatcagcgtcctgaagacgtacgaccccccg
gtcacggccgtcgagggggccgaggtgacggccgtgcgccggcacggcaagttcctggac
gtcgagacggacggcgggctgcacctggtggcccatctggcccgcgcgggctggctccag
tggaaggaccggctgcccgacggcccgccgaagccagggaagggcccgctggcgctgcgc
gtggccctggagaccggcgagggcttcgacctgaccgaggccggcacccagaagcgcctc
gccgtgtacgtcgtccgcgacccggaagaggtgcccggcatcgcccgcctcggcccggat
ccgctcgccggcgacttcgacgaggaccgcttcgccgccctgctccagggtgaacggcgg
cagctcaagggtgccctgcgcgaccagtcgctgatcgcgggcgtcggcaacgcctacagc
gacgagatcctgcacgccgcgaagatgtccccgttcaagctggccgcctccctcaccccg
gaggagacccaccggctgtacgaggcgctgcgcgacacgctcaccgaggcggtcgagcgc
tcccggggcgtggccgccgggcggctgaaggcggagaagaagggcggcctgcgcgtccac
ggccgcaccggcgaggcctgcccggtgtgcggcgacaccatccgcgaggtctccttcagc
gactcctcgctccagtactgccccacctgccagacgggcggcaagcccctggccgaccgc
cggctgtcccgcctgctgaaatga

DBGET integrated database retrieval system