KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7817Help
Entry
SHJGH_7817        CDS       T02531                                 

Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SHJGH_7817
  Amino acid metabolism
   00380 Tryptophan metabolism
    SHJGH_7817
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SHJGH_7817
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SHJGH_7817
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SHJGH_7817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8898930..8902145
Genome map
AA seq 1071 aa AA seqDB search
MPPTALRTEPAGTLTGVPVVDITASGPGRTPIQQTMELMREHGPVLVRRLHGRDVMFVAD
ANLVADLADEERFAKHVGPALRNVREFAADGLFTAYNDEPNWAKAHDILMPAFALGSMRT
YHPVMLKVARRLIDAWDRAARAGRPVDVPDDMTRMTLDTIGLAGFDYDFGSFERAEPHPF
VESMVRCLEWSMTRLARTPGTDHSAADAAFRKDADHLARVVDDVIAARTGTDQSGAEDLL
GLMLSAPHPADGTTLDAANIRNQVITFLIAGHETTSGAMSFALYYLAKHPAVLRLVQREA
DALWGDTADPEPSYEDIGRLTHTRQVLNEALRLWPTAAAFSRHAREDTLLGGRIPLRAGQ
AVTVLAPMLHRQPVWGDNPELFDPERFTPEAEAARPVHAFKPFGTGERACIGRQFALHEA
TMLLALLVHRYRLHDHAGYRLTVKETLTLKPEGFTLTLTPRTPADRVHAPLPGAAAAPAA
GTPAPDALPARVRPGTRALFLHGSNYGTCRDFAARLADEAAAVGCATEVAALDAYKDGLP
TDRPVVIAAASYNGRPTDDAVAFTAWLDGTPDLTGVTYAVLGVGDRNWAATYQQVPTRID
ARLAELGATRLTERAAADASGDLTGAVREFTARVRSALLSAYGDPDAGHDTTDEPAHAYA
VRTLSGGPLDALAERHGLVPMTVTEARDLTAPGHPRTKRFLRVALPEGVTYRTADHLTVL
PANAPELVDRAVAAFGLDADAVLDIRPTRSRPWGSARTGEAERGGALAVDRPVTVRQLLT
HHVELQERPTSRQAALLAEANPCPPERAALAALPGDDPRTLVELAEDHPALRGALDWPLL
LDLLTPLRPRHYSISSAPAADPRHADLMVSVLDAPARSGKGRHRGTGSGHLASLRPGDTV
YARVQPCREAFRIDHTAPVVMVAAGTGLAPFRGAVADRLAARRTGARLPAGLLYFGCDAP
DVDYLHAEELRAAERAGAVSLRPAFSAAPVNGAAFVQHRIAAEAGEVWELLGAGARVYVC
GDGARMAPGVRAAFRTLYRERTPGADEAAADRWLDTLVADGRYVEDVYAAG
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaccgcactgcgcaccgaaccggccggaaccctgaccggcgtccccgtcgtc
gacatcaccgcctccggccccggccgcacgcccatccagcagaccatggagctgatgcgg
gagcacggcccggtgctggtgcggcggctgcacgggcgggacgtgatgttcgtcgccgac
gcgaacctggtcgccgacctggccgacgaggagcggttcgccaagcacgtcgggcccgcc
ctgaggaacgtgcgggagttcgccgccgacggcctgttcacggcgtacaacgacgagccc
aactgggcgaaggcgcacgacatcctgatgcccgccttcgcgctgggctcgatgcgcacc
taccacccggtgatgctgaaggtggcccggcggctcatcgacgcctgggaccgtgcggcg
cgggccggccggcccgtcgacgtgcccgacgacatgacccggatgaccctcgacaccatc
gggctcgccgggttcgactacgacttcgggtcgttcgagcgcgccgagccgcaccccttc
gtggagtcgatggtccgctgcctggagtggagcatgacccggctggcccgcacccccggc
accgaccactcggcggccgacgcggccttccggaaggacgccgaccacctcgcccgggtc
gtggacgacgtcatcgccgcccgcaccggcaccgaccagagcggcgccgaggacctgctc
ggcctgatgctcagcgccccgcaccccgccgacggcaccaccctggacgcggccaacatc
cgcaaccaggtcatcaccttcctgatcgccggccacgagaccacctccggcgcgatgtcc
ttcgcgctctactacctggccaagcacccggccgtcctgcggctcgtgcagcgcgaggcc
gacgcgctgtggggcgacacggccgaccccgagccgtcgtacgaggacatcggccggctc
acccacacccgccaggtcctgaacgaggcgctgcggctgtggccgacggccgccgcgttc
agccggcacgcccgcgaggacaccctgctcggcggccggatcccgctgcgcgccggccag
gccgtcaccgtgctcgcgccgatgctgcaccgccagcccgtgtggggcgacaaccccgag
ctgttcgaccccgagcggttcacccccgaggccgaggcggcccgtccggtgcacgccttc
aagccgttcggcaccggtgaacgcgcctgcatcggacggcagttcgcactgcacgaggcg
accatgctgctcgccctgctggtccaccgctaccggctgcacgaccacgccggctaccgg
ctcaccgtgaaggagaccctcaccctcaagcccgagggcttcaccctcacgctcaccccg
cgcacccccgccgaccgcgtccacgcgcccctgcccggcgccgccgccgcgcccgccgcc
ggcacccccgcccccgacgccctcccggcccgggtccgccccggcacccgcgccctcttc
ctgcacggcagcaactacggcacctgccgggacttcgccgcccggctcgccgacgaggcc
gccgccgtcggctgcgccaccgaggtcgccgccctggacgcctacaaggacggcctgccc
accgaccggcccgtcgtcatcgccgccgcctcctacaacggccgccccaccgacgacgcc
gtcgccttcaccgcctggctcgacggcacccccgacctgaccggagtgacctacgccgtc
ctcggcgtcggcgaccgcaactgggccgccacctaccagcaggtccccacccggatcgac
gcccgcctcgccgaactcggcgccacccggctcaccgagcgcgccgccgccgacgcctcc
ggggacctcaccggcgccgtacgggagttcaccgcccgcgtgcgctccgcgctgctgagc
gcgtacggcgacccggacgccggccacgacaccacggacgagcccgcccacgcctacgcg
gtccgcaccctgtccggcgggccgctggacgccctcgccgagcggcacgggctggtcccg
atgacggtcaccgaggcccgtgacctcaccgcgcccggtcatccgcgcaccaagcggttc
ctgcgcgtcgccctgcccgagggcgtcacctaccgcaccgccgaccacctgaccgtgctg
cccgccaacgcccccgagctggtggaccgtgccgtcgccgccttcggcctcgacgccgac
gccgtcctggacatccggccgacccgttcccgcccatgggggtccgcccgcacgggcgaa
gccgagcgcgggggagccctcgccgtggaccggccggtgacggtacgccaactgctcacc
catcacgtcgagttgcaggagcgtccgaccagccgccaggcggccctcctcgccgaggcc
aacccctgcccgcccgagcgcgccgccctcgccgccctgcccggcgacgacccgcggacc
ctggtggaactggccgaggaccaccccgccctgcgcggtgccctggactggccgctcctg
ctcgacctgctgaccccgctgcgcccgcgccactactccatctcctccgcaccggcagcc
gacccccgccacgccgacctcatggtgtccgtgctcgacgcccccgcgcgctccggcaag
ggccgccaccggggcaccggctccggtcacctcgcctccctgcggcccggtgacaccgtg
tacgcccgggtccagccctgccgcgaggcgttccggatcgaccacacggcaccggtcgtg
atggtcgccgccggcaccgggctcgctccgttccggggtgccgtcgccgaccgcctggcc
gcccgccgcaccggcgcccggctccccgcgggactgctctacttcggctgcgacgccccg
gacgtcgactacctgcacgccgaggaactgcgggccgccgagcgggccggcgcggtctcg
ctgcggccggccttcagcgccgcgcccgtgaacggtgccgccttcgtccagcaccgcatc
gccgccgaggccggcgaggtctgggagctgctgggcgccggggcccgggtgtacgtctgc
ggcgacggcgcacggatggctcccggcgtccgcgccgccttccgtaccctgtaccgcgaa
cggacccccggcgccgacgaggccgcggccgaccggtggctcgacacgctggtggcggac
gggcgttacgtggaggacgtgtacgcggcgggctga

DBGET integrated database retrieval system