KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7817Help
Entry
SHJGH_7817        CDS       T02531                                 

Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sho00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sho00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sho00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8898930..8902145
Genome map
AA seq 1071 aa AA seqDB search
MPPTALRTEPAGTLTGVPVVDITASGPGRTPIQQTMELMREHGPVLVRRLHGRDVMFVAD
ANLVADLADEERFAKHVGPALRNVREFAADGLFTAYNDEPNWAKAHDILMPAFALGSMRT
YHPVMLKVARRLIDAWDRAARAGRPVDVPDDMTRMTLDTIGLAGFDYDFGSFERAEPHPF
VESMVRCLEWSMTRLARTPGTDHSAADAAFRKDADHLARVVDDVIAARTGTDQSGAEDLL
GLMLSAPHPADGTTLDAANIRNQVITFLIAGHETTSGAMSFALYYLAKHPAVLRLVQREA
DALWGDTADPEPSYEDIGRLTHTRQVLNEALRLWPTAAAFSRHAREDTLLGGRIPLRAGQ
AVTVLAPMLHRQPVWGDNPELFDPERFTPEAEAARPVHAFKPFGTGERACIGRQFALHEA
TMLLALLVHRYRLHDHAGYRLTVKETLTLKPEGFTLTLTPRTPADRVHAPLPGAAAAPAA
GTPAPDALPARVRPGTRALFLHGSNYGTCRDFAARLADEAAAVGCATEVAALDAYKDGLP
TDRPVVIAAASYNGRPTDDAVAFTAWLDGTPDLTGVTYAVLGVGDRNWAATYQQVPTRID
ARLAELGATRLTERAAADASGDLTGAVREFTARVRSALLSAYGDPDAGHDTTDEPAHAYA
VRTLSGGPLDALAERHGLVPMTVTEARDLTAPGHPRTKRFLRVALPEGVTYRTADHLTVL
PANAPELVDRAVAAFGLDADAVLDIRPTRSRPWGSARTGEAERGGALAVDRPVTVRQLLT
HHVELQERPTSRQAALLAEANPCPPERAALAALPGDDPRTLVELAEDHPALRGALDWPLL
LDLLTPLRPRHYSISSAPAADPRHADLMVSVLDAPARSGKGRHRGTGSGHLASLRPGDTV
YARVQPCREAFRIDHTAPVVMVAAGTGLAPFRGAVADRLAARRTGARLPAGLLYFGCDAP
DVDYLHAEELRAAERAGAVSLRPAFSAAPVNGAAFVQHRIAAEAGEVWELLGAGARVYVC
GDGARMAPGVRAAFRTLYRERTPGADEAAADRWLDTLVADGRYVEDVYAAG
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaccgcactgcgcaccgaaccggccggaaccctgaccggcgtccccgtcgtc
gacatcaccgcctccggccccggccgcacgcccatccagcagaccatggagctgatgcgg
gagcacggcccggtgctggtgcggcggctgcacgggcgggacgtgatgttcgtcgccgac
gcgaacctggtcgccgacctggccgacgaggagcggttcgccaagcacgtcgggcccgcc
ctgaggaacgtgcgggagttcgccgccgacggcctgttcacggcgtacaacgacgagccc
aactgggcgaaggcgcacgacatcctgatgcccgccttcgcgctgggctcgatgcgcacc
taccacccggtgatgctgaaggtggcccggcggctcatcgacgcctgggaccgtgcggcg
cgggccggccggcccgtcgacgtgcccgacgacatgacccggatgaccctcgacaccatc
gggctcgccgggttcgactacgacttcgggtcgttcgagcgcgccgagccgcaccccttc
gtggagtcgatggtccgctgcctggagtggagcatgacccggctggcccgcacccccggc
accgaccactcggcggccgacgcggccttccggaaggacgccgaccacctcgcccgggtc
gtggacgacgtcatcgccgcccgcaccggcaccgaccagagcggcgccgaggacctgctc
ggcctgatgctcagcgccccgcaccccgccgacggcaccaccctggacgcggccaacatc
cgcaaccaggtcatcaccttcctgatcgccggccacgagaccacctccggcgcgatgtcc
ttcgcgctctactacctggccaagcacccggccgtcctgcggctcgtgcagcgcgaggcc
gacgcgctgtggggcgacacggccgaccccgagccgtcgtacgaggacatcggccggctc
acccacacccgccaggtcctgaacgaggcgctgcggctgtggccgacggccgccgcgttc
agccggcacgcccgcgaggacaccctgctcggcggccggatcccgctgcgcgccggccag
gccgtcaccgtgctcgcgccgatgctgcaccgccagcccgtgtggggcgacaaccccgag
ctgttcgaccccgagcggttcacccccgaggccgaggcggcccgtccggtgcacgccttc
aagccgttcggcaccggtgaacgcgcctgcatcggacggcagttcgcactgcacgaggcg
accatgctgctcgccctgctggtccaccgctaccggctgcacgaccacgccggctaccgg
ctcaccgtgaaggagaccctcaccctcaagcccgagggcttcaccctcacgctcaccccg
cgcacccccgccgaccgcgtccacgcgcccctgcccggcgccgccgccgcgcccgccgcc
ggcacccccgcccccgacgccctcccggcccgggtccgccccggcacccgcgccctcttc
ctgcacggcagcaactacggcacctgccgggacttcgccgcccggctcgccgacgaggcc
gccgccgtcggctgcgccaccgaggtcgccgccctggacgcctacaaggacggcctgccc
accgaccggcccgtcgtcatcgccgccgcctcctacaacggccgccccaccgacgacgcc
gtcgccttcaccgcctggctcgacggcacccccgacctgaccggagtgacctacgccgtc
ctcggcgtcggcgaccgcaactgggccgccacctaccagcaggtccccacccggatcgac
gcccgcctcgccgaactcggcgccacccggctcaccgagcgcgccgccgccgacgcctcc
ggggacctcaccggcgccgtacgggagttcaccgcccgcgtgcgctccgcgctgctgagc
gcgtacggcgacccggacgccggccacgacaccacggacgagcccgcccacgcctacgcg
gtccgcaccctgtccggcgggccgctggacgccctcgccgagcggcacgggctggtcccg
atgacggtcaccgaggcccgtgacctcaccgcgcccggtcatccgcgcaccaagcggttc
ctgcgcgtcgccctgcccgagggcgtcacctaccgcaccgccgaccacctgaccgtgctg
cccgccaacgcccccgagctggtggaccgtgccgtcgccgccttcggcctcgacgccgac
gccgtcctggacatccggccgacccgttcccgcccatgggggtccgcccgcacgggcgaa
gccgagcgcgggggagccctcgccgtggaccggccggtgacggtacgccaactgctcacc
catcacgtcgagttgcaggagcgtccgaccagccgccaggcggccctcctcgccgaggcc
aacccctgcccgcccgagcgcgccgccctcgccgccctgcccggcgacgacccgcggacc
ctggtggaactggccgaggaccaccccgccctgcgcggtgccctggactggccgctcctg
ctcgacctgctgaccccgctgcgcccgcgccactactccatctcctccgcaccggcagcc
gacccccgccacgccgacctcatggtgtccgtgctcgacgcccccgcgcgctccggcaag
ggccgccaccggggcaccggctccggtcacctcgcctccctgcggcccggtgacaccgtg
tacgcccgggtccagccctgccgcgaggcgttccggatcgaccacacggcaccggtcgtg
atggtcgccgccggcaccgggctcgctccgttccggggtgccgtcgccgaccgcctggcc
gcccgccgcaccggcgcccggctccccgcgggactgctctacttcggctgcgacgccccg
gacgtcgactacctgcacgccgaggaactgcgggccgccgagcgggccggcgcggtctcg
ctgcggccggccttcagcgccgcgcccgtgaacggtgccgccttcgtccagcaccgcatc
gccgccgaggccggcgaggtctgggagctgctgggcgccggggcccgggtgtacgtctgc
ggcgacggcgcacggatggctcccggcgtccgcgccgccttccgtaccctgtaccgcgaa
cggacccccggcgccgacgaggccgcggccgaccggtggctcgacacgctggtggcggac
gggcgttacgtggaggacgtgtacgcggcgggctga

DBGET integrated database retrieval system