KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_8187Help
Entry
SHJGH_8187        CDS       T02531                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SHJGH_8187
  Lipid metabolism
   00561 Glycerolipid metabolism
    SHJGH_8187
   00600 Sphingolipid metabolism
    SHJGH_8187
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SHJGH_8187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9343862..9345961
Genome map
AA seq 699 aa AA seqDB search
MTPRQRWTLRTEHTGYTVRLSPDGPWAELHAWGPHGAEDGPSALDWSHRTHFITPADAAP
AEYVPHGLRPFTGADLIAARPGSDRGVWWSFQDAREEPGALRLTFTDDVLGLRTTLCYAT
VPGTDVLHRWTELTCTGEEELRLERLDSAAVNIPVTAAARLTYLTGQWSQEFQHTQLDLT
RGTFTMGSTQGVPGHAYAPWLAVQDATAPHDAPAPAYGIALEWPGNWHITAQAEPGGAVR
VRAGRVPHEGAVRLAPGDTLTTPRLACAFSPDGLDGLSRVWHRYERRLAGERLHRPRKVL
YNSWEATGFDVDAGSQLELAEAAADLGAELFVVDDGWFTGRADDTGGLGDWHPDPAAFPH
GFDRFVDDVRALGLDFGLWIEPEAVSPGSRLHAEHPEWVYRIDGRPARRVRNQLLLDLGR
TDVQDFVLATLDRLLTGHAIDYLKWDMNRPPTERGRPGAGPADRLDLDAEHVHGYLRVLD
HLRTAHPHVTVEGCAGGGGRVDHATLARTDVVWPSDNTAPLDRLRIQYGFLHAHAPHVMS
SWVTDAPGVFDPRPRSLAFRFVTAMCGVLGIGADLRTWTPGQRAEAAGWIARYKQVRDVI
HHGETRLLGSPGDATCAVQYDAPDGRRTVVAAFSTGPLDGAPLVPGRPARLRLRGLDPTA
AYRDAATATTYSGAHLLHYGLPCAWTADHDADLVVLTRQ
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgcgccagcgctggacgctgcgcaccgagcacaccggctacaccgtccggctc
tccccggacggcccctgggcggaactccacgcgtggggaccgcacggcgcggaggacggg
ccgtcggcactggactggtcccaccgcacccacttcatcacccctgcggacgccgccccc
gcggaatacgtgccgcacggactgcgcccgttcaccggcgccgacctcatcgcggcccgg
cccggctccgaccgcggggtgtggtggagcttccaggacgcccgcgaggagcccggcgcc
ctccggctcaccttcaccgacgacgtcctcggcctgcgcaccaccctgtgctacgccacc
gtgcccggcaccgacgtcctgcaccgctggaccgaactgacctgcaccggcgaggaggaa
ctgcgactggagcggctggactccgccgccgtgaacatcccggtcaccgcagccgccagg
ctgacgtacctgaccggccagtggtcccaggagttccagcacacgcaactcgacctgacc
cgggggacgttcaccatgggcagcacccagggcgtgcccggtcacgcgtacgccccctgg
ctcgccgtccaggacgccacggcaccccacgacgcccccgcccccgcctacggcatcgcc
ctggagtggcccggcaactggcacatcaccgcacaggccgagcccggcggcgccgtacgc
gtccgcgccggacgcgtaccgcacgagggcgcggtgcgcctggcccccggcgacaccctg
accaccccccgcctcgcctgcgcgttcagcccggacggactcgacggactctcccgcgtg
tggcaccgctacgagcgccggctcgccggcgaacgcctgcaccgcccccgcaaggtcctg
tacaactcctgggaggccaccggcttcgacgtcgacgccggcagccagctggagctggcc
gaagcggcggcggacctcggcgccgagctgttcgtggtggacgacggctggttcaccggc
cgggccgacgacaccgggggactgggcgactggcaccccgacccggcggccttcccgcac
ggcttcgaccggttcgtcgacgacgtccgcgccctcgggctggacttcggcctgtggatc
gaacccgaggccgtcagccccggcagccgcctgcacgccgaacacccggagtgggtctac
cggatcgacggccgcccggcccgccgcgtccgcaaccagctcctgctcgacctcggccgc
accgacgtgcaggacttcgtcctcgccaccctggaccggctgctcaccggccacgccatc
gactacctgaagtgggacatgaaccgcccgccgaccgagcgcggccggccgggcgccggt
cccgcggaccggctggacctcgacgccgagcacgtccacggctacctccgcgtcctggac
cacctgcgcaccgcgcacccccacgtcaccgtcgagggctgcgcgggcggcggcggacgc
gtcgaccacgccaccctggcgcgtaccgacgtcgtctggcccagcgacaacaccgcgccc
ctggaccggctccgcatccagtacggcttcctgcacgcccacgccccgcacgtgatgagc
tcctgggtcaccgacgcccccggcgtcttcgacccccgcccgcgcagcctcgccttccgg
ttcgtcaccgccatgtgcggcgtcctcggcatcggcgccgacctgcggacctggacgccc
ggacagcgcgccgaggcagccgggtggatcgcccggtacaagcaggtgcgggacgtcatc
caccacggcgagacccgcctgctgggctctcccggggacgccacctgcgcggtgcagtac
gacgcccccgacgggcgccgtaccgtcgtcgccgccttcagcaccggcccgctcgacggc
gccccgctcgtgccgggccgccccgcccggctgcggctgcgcggcctggaccccacggcg
gcctaccgggacgccgccaccgcgaccacgtacagcggcgcccatctgctgcactacggg
ctgccctgcgcgtggaccgccgaccatgacgccgacctggtggtactgacacggcagtag

DBGET integrated database retrieval system