KEGG   Shewanella putrefaciens 200: Sput200_0036Help
Entry
Sput200_0036      CDS       T02015                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sput200_0036
Enzymes [BR:shp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sput200_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(46421..47404)
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWQTVVQDTLASADGVTLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELIFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKI
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKGFVRWLASKL
DTTLNGGEPNYVLAGQNYKPVPFKGNELTHSQTRYQAYRELYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
ACRNQALNYALDFFKRYATKNSNGKVV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcaactgaacacgatttaaatacctcagagcagcaa
gccttctggcaaaccgttgtccaagatacgctagcctctgccgacggcgtcacgctggcc
tatatgatggtcaaacatccccaagcgcataccgcaattgttctcagcagtggtcgagtc
gagtcctatttaaagtatcaagaattgatcttcgacttataccaacagggttactctgtt
tatgccatagatcatcgtggccaagggctatcggatcgaatgacaatcaacccacatatg
ggacacgtgcgaagatttaatgattatatcgatgactttgctctatttatgcagaagata
gtgttaccacaaaacgacaaacaactcatgctactcggccattcaatgggtggcgcgatt
ggcactttgtatctcaaacagcatcccgatatttttactgcggcggcattttcggcgccc
atgtatggcattaaattacctatgcccaaagggttcgtgcgttggttagccagtaaactc
gataccacactcaatggcggcgagcctaattatgtgcttgcaggacaaaactataaacct
gttccattcaaagggaatgagctaactcacagccaaacccgataccaagcctaccgagaa
ttgtatgatgccgcgcctaagttacaactcggttcacccactaaccgttggttgactgaa
tctttagatgccgcagatacttgcgtactggcaacggcacaaattcgcactccgatactg
atactgcaagcgagtgaagataagattgttgataatgcggcccagaatctcgccgtgagt
acccattgccaattgaaagtaatcgctggggctgcccatgagatttttatggaaaaagac
gcctgccgaaaccaagccttaaactatgcactcgatttttttaaacgctacgcaacaaag
aattcgaatggaaaagttgtttaa

DBGET integrated database retrieval system