KEGG   Shewanella putrefaciens 200: Sput200_0094Help
Entry
Sput200_0094      CDS       T02015                                 

Definition
Malate synthase family protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sput200_0094
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sput200_0094
   00630 Glyoxylate and dicarboxylate metabolism
    Sput200_0094
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sput200_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(107181..107744)
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQSNLNSLIAEEVFAVAQVNVAEHEKIANAKQFLDRVFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFGGTKDSPSAVVLQDQGCHVELSFDRNGMIGT
RDVANLEDIQIETPLNMVAGTPESRSAASRHWLSLLHAGMSSANDTLEKQFTAKDGSDYS
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaatcgaatctaaacagtctcatcgca
gaagaagtatttgccgtggcccaagtgaatgttgcagaacacgagaagatcgccaacgca
aaacagtttcttgaccgagtgtttccgctcaactctggctcacatcaagatgtcagtagc
tatgtcgtctactaccaacatctcttagcattttttgccgatggcagtcacagtggttta
cgtcagccaaaacaatttgtcgcctttggtggaacgaaagactcacccagcgccgtagtg
ttacaggatcaaggttgccatgttgagctcagtttcgatcgcaatggcatgataggcacc
agagatgtggctaatctggaggatatccaaatcgagacaccattaaatatggtggcagga
acaccagagtcacgctcagccgcatcacgccattggctaagtctgttgcacgcaggaatg
tccagcgccaacgacacgctagagaagcaattcacagccaaagatggcagcgattacagt
ttgaaaagtatagtaaatttataa

DBGET integrated database retrieval system