KEGG   Shewanella putrefaciens 200: Sput200_0094Help
Entry
Sput200_0094      CDS       T02015                                 

Definition
Malate synthase family protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sput200_0094
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sput200_0094
   00630 Glyoxylate and dicarboxylate metabolism
    Sput200_0094
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sput200_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(107181..107744)
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQSNLNSLIAEEVFAVAQVNVAEHEKIANAKQFLDRVFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFGGTKDSPSAVVLQDQGCHVELSFDRNGMIGT
RDVANLEDIQIETPLNMVAGTPESRSAASRHWLSLLHAGMSSANDTLEKQFTAKDGSDYS
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaatcgaatctaaacagtctcatcgca
gaagaagtatttgccgtggcccaagtgaatgttgcagaacacgagaagatcgccaacgca
aaacagtttcttgaccgagtgtttccgctcaactctggctcacatcaagatgtcagtagc
tatgtcgtctactaccaacatctcttagcattttttgccgatggcagtcacagtggttta
cgtcagccaaaacaatttgtcgcctttggtggaacgaaagactcacccagcgccgtagtg
ttacaggatcaaggttgccatgttgagctcagtttcgatcgcaatggcatgataggcacc
agagatgtggctaatctggaggatatccaaatcgagacaccattaaatatggtggcagga
acaccagagtcacgctcagccgcatcacgccattggctaagtctgttgcacgcaggaatg
tccagcgccaacgacacgctagagaagcaattcacagccaaagatggcagcgattacagt
ttgaaaagtatagtaaatttataa

DBGET integrated database retrieval system