KEGG   Shewanella putrefaciens 200: Sput200_0094Help
Entry
Sput200_0094      CDS       T02015                                 

Definition
(GenBank) Malate synthase family protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00620  Pyruvate metabolism
shp00630  Glyoxylate and dicarboxylate metabolism
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
shp01200  Carbon metabolism
Module
shp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sput200_0094
   00630 Glyoxylate and dicarboxylate metabolism
    Sput200_0094
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sput200_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2431
Motif
Other DBs
NCBI-ProteinID: ADV52584
UniProt: E6XPF0
Position
complement(107181..107744)
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQSNLNSLIAEEVFAVAQVNVAEHEKIANAKQFLDRVFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFGGTKDSPSAVVLQDQGCHVELSFDRNGMIGT
RDVANLEDIQIETPLNMVAGTPESRSAASRHWLSLLHAGMSSANDTLEKQFTAKDGSDYS
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaatcgaatctaaacagtctcatcgca
gaagaagtatttgccgtggcccaagtgaatgttgcagaacacgagaagatcgccaacgca
aaacagtttcttgaccgagtgtttccgctcaactctggctcacatcaagatgtcagtagc
tatgtcgtctactaccaacatctcttagcattttttgccgatggcagtcacagtggttta
cgtcagccaaaacaatttgtcgcctttggtggaacgaaagactcacccagcgccgtagtg
ttacaggatcaaggttgccatgttgagctcagtttcgatcgcaatggcatgataggcacc
agagatgtggctaatctggaggatatccaaatcgagacaccattaaatatggtggcagga
acaccagagtcacgctcagccgcatcacgccattggctaagtctgttgcacgcaggaatg
tccagcgccaacgacacgctagagaagcaattcacagccaaagatggcagcgattacagt
ttgaaaagtatagtaaatttataa

DBGET integrated database retrieval system