KEGG   Shewanella putrefaciens 200: Sput200_0094Help
Entry
Sput200_0094      CDS       T02015                                 

Definition
Malate synthase family protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:shp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:shp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:shp00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(107181..107744)
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQSNLNSLIAEEVFAVAQVNVAEHEKIANAKQFLDRVFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFGGTKDSPSAVVLQDQGCHVELSFDRNGMIGT
RDVANLEDIQIETPLNMVAGTPESRSAASRHWLSLLHAGMSSANDTLEKQFTAKDGSDYS
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaatcgaatctaaacagtctcatcgca
gaagaagtatttgccgtggcccaagtgaatgttgcagaacacgagaagatcgccaacgca
aaacagtttcttgaccgagtgtttccgctcaactctggctcacatcaagatgtcagtagc
tatgtcgtctactaccaacatctcttagcattttttgccgatggcagtcacagtggttta
cgtcagccaaaacaatttgtcgcctttggtggaacgaaagactcacccagcgccgtagtg
ttacaggatcaaggttgccatgttgagctcagtttcgatcgcaatggcatgataggcacc
agagatgtggctaatctggaggatatccaaatcgagacaccattaaatatggtggcagga
acaccagagtcacgctcagccgcatcacgccattggctaagtctgttgcacgcaggaatg
tccagcgccaacgacacgctagagaagcaattcacagccaaagatggcagcgattacagt
ttgaaaagtatagtaaatttataa

DBGET integrated database retrieval system