KEGG   Shewanella putrefaciens 200: Sput200_0344Help
Entry
Sput200_0344      CDS       T02015                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sput200_0344
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sput200_0344
Exosome [BR:shp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sput200_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
366082..367566
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
VEALARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQCRRSAEICEQLKAQGL
EEYVRENTGLLLDPYFSGTKIKWILDNVPNAREQADRGELLFGTIDTWLVWKLTEGKVHV
TDPTNAARTLLFNIHSLTWDNKLLEALDIPLSMLPDVKPSCSVYGTTRIAGEGSEIQVAG
MAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRSNHGLLTTVAVGPKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSGVSLKRLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIELEHKACIDKHFIPNIDAQTRVQ
LYAGWQDAVARTRT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatacgtggtggccttagatcaaggcacgacaagctcaagggcgatagtg
ttcgatcacgacgcaaacattgtcagcgtgtcccagcgggaatttacccagttgtatcct
aatccaggttgggtcgagcatgatcccatggagatttgggcaagccaaagttcagtgtta
gttgaagcgctggcgcgtgcgggtattcacagcgatgaagtggcggccattggcataacc
aatcagcgggaaaccaccgttatttgggagaaggccacaggtaaacctatttataacgcg
attgtgtggcagtgccgtcgcagcgctgagatttgtgagcaactcaaagctcaagggtta
gaagaatatgtgcgtgagaataccggtttattactcgacccttatttttcaggcactaag
atcaaatggattttagataatgtgcccaatgcccgtgagcaagccgatcgtggtgagttg
ttgttcggcactatcgatacttggctcgtgtggaagttaaccgagggcaaggtgcatgtc
accgatcccaccaatgctgcccgcacgttgctattcaatatccatagcctgacttgggat
aataagttactcgaagccttagatattcccttgtctatgttgcctgacgttaaaccctcc
tgcagcgtgtatggcaccacacggattgccggtgaaggcagtgaaatccaagttgcagga
atggcgggcgatcaacaggctgcgctttttggccagttatgtgttgagcccggcatggcg
aagaatacctacggcactggttgttttttgttgatgaatactgggaccaaagcggtgcgc
tcaaaccatggtttattgactacagttgccgtggggcctaagggtgaagtgaactatgcc
ctcgaaggttcagtttttatgggcggcgcgaccattcaatggttgcgggatgaactcggg
cttattcgtgatgccagtgataccgaatactttgcctctaaggtcgccgatactaatggc
gtatatctggttcccgcttttgtgggactcggggcgccctattgggatcccaatgcccgt
ggcgcgctatttgggttaacccgcggcgccaaccgtaatcatattattcgggcggcgtta
gaatccatcgcttatcagagtaaagatttactcgatgccatgatcaaagacagtggcgtc
agccttaagcgtttaaaagtggatggtggcgcggtcgccaatgattttttgatgcagttt
caagcggatattaccgatgttgaggtactaaggccaagcgtttgtgagacaaccgctttg
ggcgcggcatttttagctgggctggcggtgggcttttgggagagtgtgatagagcttgag
cacaaagcctgcatcgataagcattttatccctaatatcgatgctcagactcgagtgcag
ctatatgcaggttggcaggatgcggtggccagaactcgaacataa

DBGET integrated database retrieval system