KEGG   Shewanella putrefaciens 200: Sput200_0350Help
Entry
Sput200_0350      CDS       T02015                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shp  Shewanella putrefaciens 200
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:shp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:shp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
371979..373481
Genome map
AA seq 500 aa AA seqDB search
MMLLRDLLAPWFIYSGDQSFNELTLDSRAIRRGDVFLALPGHRVDGRQFIDKALDLGAAG
VLVHTDDADQHGKVLLGDNAERGVQIYFFQLNRQVSAIAAQRYPLAHQFAVTPSLGIIGI
TGTNGKTSTSQLIAQLVTSLGRKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHEFEA
QGASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMESYTAAKQSLFRFSTL
GHGLLNLDDPVGETWLIELKDMAAQIWGFSIEGHQAAAFYTKNTQFDDQGVSATLVWPEG
ETQIHSPLLGAFNLSNLLAALSALYLQGFDMEALAEQVQYLTPVAGRMERFTTADNITLV
VDYAHTPDAIEQALTALRRHCAGDLWCVFGCGGDRDKGKRPLMGRAAEQYADRIMVTSDN
ARSEDPAQIISDIIQGLVTPERALTQVDRITAIKDVVGLAKSGDLILLAGKGHETYQEAA
GVRHNYDERALARQLAEQSK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgctacgggacctgttagcgccttggtttatatattcgggtgatcaatctttc
aatgagttgaccttagatagccgcgcaatacgccgcggcgatgtgtttttggcgttgcca
gggcatagagtcgatggcagacagtttattgataaagccttagatttaggtgccgcaggc
gtattagttcacacggatgatgctgaccaacatggcaaagtgttgcttggcgataatgct
gagcgtggcgtgcagatttattttttccaattaaatcgtcaggtatcagcgatagccgcc
cagcgttatcccttagcgcaccagtttgccgttacgccatcccttggcattatcggcatt
accggcaccaatggtaaaacctcaactagtcaacttattgcacagctagtgacgtcattg
gggcgaaaagctgctgttatgggtacattgggaaatggcctatggggtgaactagttgat
agcggtaataccactgccgatgcgattaccctaatgcgtcagttgcatgaatttgaagcc
caaggcgcgagcgtttgtgctatggaagtgtcgagccacgggctagtgcaaggccgcgtc
gatgcagtaccattcgatgtcgccgtgttcactaacttaacgcgcgatcacctcgattac
cacggcgacatggaaagctataccgccgctaagcaaagcctatttcggtttagcacttta
ggccatggtttattgaatctcgatgaccctgttggcgaaacttggttgattgagcttaaa
gacatggctgcacagatctggggctttagtatcgaaggccaccaagccgcggctttttat
accaaaaatactcagtttgacgatcaaggcgtaagtgcaactttagtgtggcccgagggc
gaaactcaaattcactcgccccttctgggggcttttaatctttccaatttacttgcggcg
ttatcggccttgtatctgcaaggttttgatatggaagccttagccgagcaagtgcagtat
ttaacgcctgttgcgggtcgtatggagcgttttactacggcggataacatcaccttagtc
gtcgattatgcacatacacccgatgcgatagagcaggcattaacggccttgcgccgtcat
tgtgcgggggatttatggtgcgtgtttggttgcggtggagaccgcgataagggcaagcgc
cctttgatggggcgtgccgctgagcaatatgcagaccgtattatggtgaccagtgataat
gcacgcagcgaagatcctgcacaaattattagcgatattatccaagggcttgtcactcca
gaacgagcattgactcaggttgaccgtatcacagcaattaaagacgttgtgggattggct
aaatctggcgatctgatcttacttgcgggcaaaggccacgaaacttaccaagaggcggca
ggcgtgcgtcataactatgatgaacgcgctttggcacgccagttagcggagcaatcaaaa
tga

DBGET integrated database retrieval system