KEGG   Shewanella putrefaciens 200: Sput200_1075Help
Entry
Sput200_1075      CDS       T02015                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
shp  Shewanella putrefaciens 200
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sput200_1075
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sput200_1075
Enzymes [BR:shp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sput200_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1199841..1202543
Genome map
AA seq 900 aa AA seqDB search
MNKTFAATAILVALGLTACSDVPDAQVVNQAPKPAHASPASEVNAVSGALTQTQLQQLGD
TLTATYRVVTNIPDEQCNKALAEGRCFVAEIDFVPGIDIASHDWSIYFSQMRPVQSVQSD
EFTISHVKGDLYRIAPTVAFTGFSKGVKKTLRFRGELWQLSETDAMPNYYLVAEHLAPVL
IASTQVVQDPETKLEVRPYVEGYTDMVKQYRCTETDKLQPADAARLFINNQAVSEDAALA
TNAIIPTPQKVQVHGTDKAVSLAAGIKVDYQQLDPTLLTPSQVAAALARLARLGVAENDQ
GLAVKLQHSAGNEGSYQLDIKANEINIAAADAAGFSYALSSLASLIDVQDLRVNAMTIED
SPRYPFRGMHIDVARNFHSKQLLLDLLDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTD
IGSQRCHDLAENTCLLPQLGSGPFAELSVNGFYTKQDYIDIVKYAEARQIQVIPSMDMPG
HSRAAIKSMEARYRKLLAEGKAAEAKTYLLSDADDKTVYSSVQYYDDNTLNVCMESTYQF
VDKVIDEIAKLHQAAGQPLTRYHIGADETAGAWKQSPQCLAFVANNDKGVKSIDELGAYF
IERISNQLANKGIEAAGWSDGMSHVRPENMPAKVQSNIWDVIAHKGHSRANQQANLGWET
VLSNPEVLYFDFPYEADPKEHGYYWASRATNSHKVFSFMPDNLAANAEQWTDIQHQPFEA
DDRIKLDEAGKKVSGPREEGKAFSGLQGQIWSETIRSDDTAEYMIFPRLLMLAERAWHQA
AWEVPYQYQGAVYNQNSGAFTLAMREVQAKDWQQLANTLGHKEFIKLDKAGINYRVPTVG
AEIRDGKLFANIAYPGLKLEYRSLNGQWQAYRAGLAVTAPIEIRAIAADGIRKGRSLIVN
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacatttgccgcgaccgctatactcgtcgcacttggtttgactgcatgttca
gatgtgccagatgctcaggtagtaaatcaggctcccaaacctgcacacgcctcgcctgcc
agtgaggttaacgccgtttcaggtgcattaactcaaactcaattgcagcaattgggggat
accttaacagccacttaccgtgttgtgactaatattcccgatgagcaatgtaacaaagcg
ctggccgagggtcgctgctttgtggccgaaatcgattttgtaccgggaatcgatattgcc
agtcacgactggtcgatttacttcagccaaatgcgtccggtgcaatcggttcagagcgat
gaatttacaatctcccacgtaaagggcgacttataccgcattgcaccgactgtggctttt
accggttttagcaaaggtgtgaaaaagaccctgcgattccgtggtgagttatggcaattg
tcagaaactgatgccatgcctaattactacttagtggccgaacatttagcgccagtattg
attgcgagtactcaggtggtgcaagaccctgaaaccaaattagaagtgcgtccctatgtc
gaaggttacactgacatggtgaagcaatatcgctgcactgaaactgataaattgcaaccc
gctgatgcagcaaggttatttatcaataatcaagcagtaagcgaagatgccgcactagcg
actaatgctattattcctacgccgcaaaaagtgcaagtacatggcaccgataaagccgtg
tctttagctgcgggtattaaagttgattatcaacagcttgatccaacactgctgacgcca
agtcaagttgcggccgcattagcgcgtttagcccgtcttggagtggctgaaaacgatcaa
ggtctagcggttaaattgcagcatagtgcgggcaatgagggcagttatcagctcgatatc
aaggctaacgaaatcaacatcgccgcagccgatgctgccggtttttcctatgcgctatct
tcgctggcgagtttgattgatgtgcaagacttgcgagtcaatgcgatgactatcgaagat
agtccacgttatccgtttcgtggtatgcacattgatgtggctcgtaatttccacagcaaa
caattgttgctggatttgctcgaccaaatggcggcttataagctcaataaactgcattta
cacatggctgacgatgaaggttggcgactcgaaatcgacgggttacctgagctgaccgac
atcggtagtcaacgttgtcatgatcttgctgagaatacctgtctgttaccgcagctgggt
agcggcccttttgcggagttgagtgttaatggtttctatactaaacaagactatatcgac
atagtgaaatatgctgaggcgcgtcaaattcaagtgatcccatcgatggatatgccgggc
cacagccgagcggcaattaagtcgatggaggcgcgctaccgtaagttactcgccgaaggt
aaagccgctgaggctaagacttacctgctttcggatgcggacgataaaaccgtttattcc
tcggtgcagtattatgacgacaacacgctgaacgtatgcatggaatcgacctatcagttt
gtcgataaagtgattgatgagattgccaagttacatcaagccgctggtcagccattaacc
cgttatcatatcggtgcggatgaaaccgctggcgcttggaagcaatcgccccagtgtttg
gcgtttgtggccaataacgacaagggcgtgaaatcaatcgacgaattaggcgcttacttt
attgagcgcatctcaaatcagttggcgaataaaggcattgaagctgcgggatggagcgat
ggtatgagccatgttcgccctgagaatatgcccgctaaggtacagtctaatatttgggat
gtgattgcccacaaaggtcattcgcgcgccaatcagcaggcgaatctcggctgggaaacc
gtactttctaatcctgaggtgttgtactttgacttcccctatgaggccgatcctaaagag
catggttattactgggcaagccgagcgaccaatagccataaagtctttagctttatgcct
gataatttagccgctaacgccgagcaatggaccgatattcaacatcagccattcgaagca
gatgacagaataaaactcgatgaggcgggtaaaaaagtctcgggtccaagggaagaaggc
aaagcttttagcggccttcaagggcagatctggagcgagacaattcgcagtgacgatact
gccgagtacatgatatttccacgtttgttgatgctggctgagcgtgcttggcatcaagcc
gcgtgggaagtgccttatcagtatcaaggcgctgtgtataaccaaaactccggagctttt
accttagccatgcgtgaggtacaggcaaaagattggcaacaactcgcgaatactttgggc
cacaaagagtttatcaagctagataaagcgggaattaattatcgcgtaccgacggtcggc
gctgagatccgtgacggtaaactgtttgccaatatcgcctatcccgggcttaaactcgaa
taccgtagtctcaatggccagtggcaagcttatcgagcgggattggcggtcactgcacca
attgagatcagagccattgcggccgatggtattcgtaaaggccgaagtttaatcgttaac
taa

DBGET integrated database retrieval system