KEGG   Shewanella putrefaciens 200: Sput200_1246Help
Entry
Sput200_1246      CDS       T02015                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sput200_1246
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sput200_1246
   00630 Glyoxylate and dicarboxylate metabolism
    Sput200_1246
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sput200_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1387068..1388795
Genome map
AA seq 575 aa AA seqDB search
MVIGDATALEVSVKPVNSGASWEGIKMTEHTLSEQQLNSTLGKAAPNATLDIVGPDIPGQ
EVIFTDGAVALLESLCREFAGEVPVLLAKRKEKQARIDKGGLPDFLPETRAIRDGAWQIR
GIPTDLLDRRVEITGPVERKMVINALNANAKVFMADFEDSLAPSWQKVVEGQINLRDAVR
GDIEYTAPETGKHYKLGPHPAVLICRVRGLHLKEKHVQFNGESIPGSLFDFALYFYHNYR
QLLAKGSGPYFYIPKLESHIEARWWAKVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDE
ILYELRSNIVALNCGRWDYIFSYIKTLKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCH
KRGALAMGGMAAFIPAKDPAQNEAVLQRVRRDKELEARNGHDGTWVAHPGLADTAMGIFN
EYIGQDHCNQLHITRDVDAPILAAELLKTCDGERTEQGMRLNIRIALQYLEAWISGNGCV
PIYGLMEDAATAEISRASIWQWIQHGKSLSNGKLVTKQLFKDMLVEELANVKEEVGSDRF
TSGKFTQAAVLLEDITTSDELVDFLTLPGYEMLTA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtggtgattggggatgctactgctttagaagtcagcgttaagcctgtgaatagtggagcc
tcttgggagggcatcaagatgacggaacacactttgagtgagcagcaattgaattcgaca
ctgggtaaagccgcaccaaacgcgacacttgatattgtggggcctgatattcctggacaa
gaggtgatttttaccgacggggctgtagccttactcgaatctctttgccgcgagtttgct
ggcgaggttcctgtgctacttgctaaacgtaaagaaaagcaagctcgcatcgataaaggg
ggattaccagacttcttacctgaaacccgtgctattcgggatggtgcgtggcaaatccgc
gggatcccaacagatcttctcgaccgtagagtcgaaattactggccccgttgaacgtaaa
atggtgatcaatgcgcttaatgctaacgcaaaagtatttatggccgatttcgaggactct
ttagcgccaagttggcaaaaagtggtagaaggccagattaacctgcgtgatgctgttcgt
ggtgatatcgaatataccgcgccagaaacaggtaaacattacaaacttggccctcatccg
gcagtacttatttgccgtgttcgcggcttacatttgaaagaaaagcatgtgcaatttaac
ggtgagtctattcctggttcactgttcgatttcgcactgtatttctatcacaactatcgc
caactcttagcaaagggcagtggtccatacttctatattcctaagttagaaagccatatt
gaagctcgctggtgggcaaaggtgtttgcttttgttgaggaaagattttgtcttcaagca
ggcacaatcaaatgtacttgcctaattgagactttgcctgccgtgttcgagatggacgaa
attctctatgaattgcggtctaatattgtggcgcttaattgtggccgttgggattacatt
ttcagctatatcaaaacattaaaacgccatagcgaccgagtgttacccgatcgtcaagct
gtcactatggatacacccttcttaagtgcttattcaagactcctgattaagacctgccac
aaacgcggtgctttagcgatgggcggtatggcagcctttattccagcaaaagatcccgct
cagaacgaagcagtattgcagcgggttcgtcgggacaaagagcttgaggcgcgtaatggc
cacgatggtacttgggtcgcccatcccggtcttgccgataccgcgatggggatttttaac
gaatatataggtcaagatcattgtaatcaattacatattacccgtgatgtagatgctccc
attctagcggctgagttacttaaaacctgcgatggtgagcgtactgagcaaggtatgcgt
cttaatattcgtattgcgttgcagtatttagaggcgtggattagtggcaatggctgtgta
cctatttatggtttgatggaggacgcggctaccgccgaaatttctagagcctcaatttgg
caatggatccaacatggtaagtcactctctaatggcaagcttgtgactaagcaactcttc
aaggacatgttggtggaagaactcgcgaatgtgaaggaagaagtgggaagtgacagattt
accagtggcaaattcacccaagcggcggtgttactggaagatattactacctctgatgag
ttggtcgatttcttaactttacccggttacgagatgctaacggcttaa

DBGET integrated database retrieval system