KEGG   Shewanella putrefaciens 200: Sput200_1255Help
Entry
Sput200_1255      CDS       T02015                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
shp  Shewanella putrefaciens 200
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sput200_1255
Enzymes [BR:shp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sput200_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1397408..1399645
Genome map
AA seq 745 aa AA seqDB search
MGLEKLLYLRGVGAEFTDCFGQYIRISETDRQGILTCMLLDNASTDGDPQFASAAQALLS
DESIAQQIYELDALPWTQVLPEFQWCFVDEPWISLYLPYSYKSDINITIHCEDGESILLN
VPFSTLKVIGDYRIPEAQGERQYIQYRLDLIEYGVKNNTLYTQTNMADEGLNHFPVLGLG
YHTITFVLPPTALVSHDLLEAQVFHGTLMVAPRTAYQGVLSTAIQGKRHKPWGVSIQLYS
LRSETQWGIGDFGDLEALITLVATQGADFIQLNPLHALDIAAPEHSSPYSPCDRRRLNPL
YIHMQSVPEYELLATEFASSSWQEAIHVLHQDNWLNYPKITDLKYRAFARLYCLFCEKHL
TLQTPRAKHFHDFVAEQGAALLEFAEAECLRSPRAIVQDAGFYLYLQFVAQSQLALCQLK
AKEAGMGIGLIRDLAVGAALHGVEVQANVAQFCLNVSIGAPPDPFAPQGQNWGLTPLDPI
KLKQDNFRHFIALMRANMEHCGALRIDHVMGLLRLWWWPLDKNLGKGAYVYYPVETLLAI
VCLESQRARCVVIGEDLGLVPPDIIHRLYNAGIYGNELFYFCRDHQGFKAPSQYKPQSLM
MLANHDVPTLVAWWSGSDLHLRRQLSLFETDDQLASALAERAHEKQQLLSLLVHQGLLGE
TSVQEIDIPSLLTAWMTLGASGNSALYSVQWCDLLADSYAVNIPGTWLEYPNWQRHLPQG
IEQAAKMPELLQRLQHIAAARQLPH
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagaagttgctgtatttgcgaggggttggagcagagtttacggattgcttt
ggccagtatatccgcatttctgaaaccgatagacaaggcattctaacgtgcatgttgctg
gataatgcctctactgatggcgatccccagttcgcatctgctgcgcaagcgttattgagt
gatgagtcaatcgcacaacaaatttatgagcttgatgcgcttccttggacccaagtgttg
cctgagtttcaatggtgttttgtcgatgaaccttggataagcctttatcttccatatagt
tacaaaagtgatatcaatatcactatccattgtgaggatggcgagtcgatcctattaaat
gtgccattttctacactgaaagtgattggagattatcggatcccagaggctcaaggagaa
cgtcagtatatacaatatcgacttgatctcattgagtatggtgtcaaaaacaacacactt
tacactcaaacaaacatggccgatgaaggactcaatcatttcccagtattgggtttaggt
taccatacaattacttttgtattaccgccaacggcgcttgtcagtcatgatcttttagag
gctcaggtattccatggcacgctaatggtggcgccacgtacggcatatcaaggcgtgcta
agtactgctatccaaggaaaacgccataaaccatggggcgtgagtattcaactttacagt
ttacgtagtgaaacccaatggggaataggtgactttggtgatcttgaagcgcttatcact
ttagttgcaacacagggcgctgattttattcaacttaacccattgcatgcccttgatatt
gccgcacctgaacactcaagcccatacagtccttgcgatcgccgtagactcaatcctctc
tatattcatatgcaaagcgtacccgagtacgagttactcgccacagagtttgcttcatcg
agctggcaagaggcgattcatgtactacatcaagataattggcttaattaccctaaaata
accgatctgaaataccgagcttttgctcgtttatattgcctattctgtgaaaagcattta
acactacaaacccccagagcaaaacatttccatgactttgtggctgagcagggcgctgca
ctgctggaatttgccgaagcggaatgtcttagaagtccaagggcaattgtgcaggacgca
ggattttatctgtacttacaatttgtcgcacaaagtcagttagcactttgccaattaaaa
gcgaaagaagcgggaatggggattggcctcattcgcgatcttgccgttggcgccgcactt
catggcgtagaagttcaagccaatgtggcgcaattttgtttgaatgtgagcataggtgca
ccgcctgatccctttgcaccacaagggcaaaattggggactaacgccattagatcctatc
aaactcaaacaagataattttcggcattttatcgcacttatgcgcgccaacatggaacat
tgcggcgcactgcgaattgatcatgtgatgggattgctgcgtttatggtggtggccgctg
gataaaaatttaggtaagggtgcctatgtttattaccccgttgaaaccttgcttgccatt
gtttgccttgaaagccaacgagcccgctgtgtcgtgattggggaagatttagggctagtg
cctcctgatattattcatcgactctataacgcaggtatttacgggaatgagttgttttat
ttttgccgcgaccatcagggttttaaagctcccagtcagtacaaaccccaaagtttaatg
atgcttgccaatcacgatgtgcccactttagtcgcttggtggagtggcagtgatttgcac
ctgaggcggcaattatctctgtttgaaaccgacgatcaattagccagtgccttagctgaa
cgagcgcatgaaaaacagcaattactttctcttttagtgcaccaaggcctattaggtgaa
acaagtgttcaggagatagacataccaagcttattaacggcatggatgaccttaggggcc
tcgggtaacagtgcgctttacagtgtgcaatggtgcgatttgttagccgatagctatgcg
gtcaatattccggggacttggctcgaataccctaattggcaaaggcatttaccccaaggg
attgagcaggcggcaaagatgccagagctcctgcagcggctacaacatatcgccgctgct
aggcagttgcctcactaa

DBGET integrated database retrieval system