KEGG   Shewanella putrefaciens 200: Sput200_1256Help
Entry
Sput200_1256      CDS       T02015                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shp  Shewanella putrefaciens 200
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sput200_1256
Enzymes [BR:shp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sput200_1256
Exosome [BR:shp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sput200_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1399710..1401947
Genome map
AA seq 745 aa AA seqDB search
MMTQANAYFYNGADVALLNGQYTDVFSLLGMHTSEDGKSLIVRCFLRNALKVDVISIKDG
RRVAGLEKVNDAGLFAGTMGRRVKPFLYLLRIQYPLSQIEIVDPYQFGPLLNADDLYLFG
EGSAERAYEFLGANWRDVEGIEGVHFCVWAPNAKRVSVVGDFNHWDDTRHVMRQHMANGL
WEIFLPNVAEGAHYKFDLVHPNGERHAKSDPMATQMECAPHNASIVPKKSKHSWKDTLWL
NKRAVTAWHKAPMAIYEVHLGSWRRKGDNGEQYLDYQDLIEQLIPYVKAQGFTHIELMPI
SEYPFDGSWGYQPVGLYAPTHRFGDANGLKAFVDACHQADIGVVLDWVAAHFPKDPHGLV
RFDGTCLYEHEDPRKGTHPDWDTLIYNYGRGEVRSFLLSNACYWLREFHFDGLRLDAVSS
MLYLDYSREPGQWLPNAYGGRENLEAISFLQILNQRLYQAFPGICMIAEESTAFAGVTKP
TDHHGLGFGFKWNMGWMNDSLSYLSRDPIYRQYHHHQLTFSLMYAYTEQFMLSVSHDEVV
HGKGSLLHKIPGDDWQKFATLRAYYGFMWGHPGKKLLFMGSEFAQRDEWDHNHSLDWHLL
AFEPHQGVQRWLKDLNQLYQGMSALSVLDYQPAGFRWLDCDNGSASIFTFVRYGLAGDAP
LVFVINMTPSVHHGFRIGLPQAGDFCEYLNSDSYFYGGSNQGNAGLVVAQNQPWQGMESS
ALITVPPLSCLVLGPAANQVEAKRR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcaagccaatgcttacttctataacggtgccgatgtggcgctgctcaacggt
caatatacggacgtattttcactcttaggcatgcacacttctgaagatggaaaatcgtta
attgttaggtgttttttacgcaatgcgctcaaggttgatgtgattagcattaaagatggt
cgtagggtagcgggtcttgagaaggtcaatgatgcgggcttgtttgcaggtactatgggg
cggcgagttaagccatttctgtacttgttgcgaatacaatatccgcttagccaaatagaa
attgtcgatccctatcagtttggtcctttactcaatgccgatgatttatatctgtttggt
gaagggagtgcagagcgagcatacgaatttttaggagcgaactggcgcgatgttgaaggt
attgaaggagtacatttttgtgtatgggcgcctaatgctaaacgggtttctgtggtcggt
gattttaaccactgggatgatactcggcatgtgatgcgccaacatatggccaatggtttg
tgggagatttttctgcccaacgtggcggaaggtgcgcactacaaatttgatttggtccac
ccaaatggagaacgccacgcaaaatcggatccaatggcgactcaaatggagtgtgcgccg
cataatgcgtctattgttcctaaaaaatccaaacacagttggaaagatacattatggttg
aacaagcgagcagtaacggcgtggcataaagcccccatggcgatttatgaagttcactta
ggttcatggcgacgtaagggcgataatggtgagcaatatcttgattatcaagatttaatt
gaacaacttattccctatgtcaaagcccaaggtttcacccacattgaattgatgcccatt
agtgaatacccctttgatgggtcatggggatatcagcctgtaggtctatatgccccgacc
catagatttggtgatgctaacggccttaaggcatttgtggatgcctgccatcaggcggat
atcggtgtggttctcgattgggttgcggcacatttccctaaggatccccacggcctagtg
cgttttgatggtacttgtttgtatgaacatgaagatccgcgcaagggcacgcatcctgac
tgggacacgttaatttacaactatgggcgtggcgaagtgcgtagctttttactgagcaat
gcatgctattggctacgtgagtttcattttgatggcttgaggctcgatgcggtatcgtcg
atgttgtaccttgattacagccgtgagccgggtcaatggctaccgaatgcctatggtggt
cgagaaaacctcgaagccatcagttttctgcaaatactgaatcaacgcttgtatcaagcc
tttcccggtatttgcatgatagccgaagagtccaccgcctttgcgggcgtcacaaaaccg
acagatcatcatggtttgggctttggctttaaatggaatatgggttggatgaatgacagc
ttaagttacttaagccgtgatcccatttatcgtcaataccatcatcatcaactgaccttc
agtttaatgtatgcctataccgagcaatttatgttgtcagtgagccatgatgaggtggtc
catggcaagggctcactattgcataaaattcccggtgacgattggcaaaaatttgctact
ttgcgcgcttattacggttttatgtgggggcatcccggtaagaagttgctgttcatgggc
agtgaatttgctcagcgggatgagtgggatcataaccacagcttggattggcatttatta
gcgtttgaaccacaccaaggggtgcaacgctggcttaaggatctgaatcagttataccaa
ggcatgtctgcgttatcagtgcttgactaccaacccgcaggctttcgttggcttgactgc
gataatggcagtgccagtatttttacctttgtgcgctatggccttgcgggggatgcaccc
ctcgtctttgtcatcaatatgacacccagtgttcaccatggatttcgcatcggtttaccc
caagcgggggatttttgtgagtacctcaatagcgatagctatttttatggtggtagcaac
caaggtaatgcaggtcttgtggttgcccaaaaccaaccatggcaggggatggagtcgagt
gcacttattacggtaccaccccttagctgtttagtccttggccctgcagccaatcaggtt
gaggctaaaagaagatga

DBGET integrated database retrieval system