KEGG   Shewanella putrefaciens 200: Sput200_1364Help
Entry
Sput200_1364      CDS       T02015                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
shp  Shewanella putrefaciens 200
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sput200_1364
Enzymes [BR:shp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sput200_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1539216..1540406
Genome map
AA seq 396 aa AA seqDB search
MQNMVILGATGSIGASTLSVISANPLAYCVYGLVANASVDKMLALCITHQPKVAHMVDAV
AAKALRAQLPAALNIQVTTGNDELLALVTSSKVDTIMAAIVGAAGLVPTLAAVNAGKRVL
LANKEALVMSGELFIEVTKRSGATLLPVDSEHNAIFQCLPQEVQANLGRCDLAASGISHI
LLTGSGGPFLRSDLATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNT
QANQLKVVVHPQSVIHSMVQYIDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFK
VGQLSFYEPDFERFPCLALAMAACAQGQEATTVLNAANEIAVEAFLQGQIGFTQIAKVNE
TCLAFVPSGTMTSIEDIIALDTQSRIYARETLAKIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatggtgattctgggtgcgacaggctcgattggcgccagtaccttaagtgtg
atttcggctaatccattggcttattgcgtttatggcttagtggctaatgcgagtgtggat
aaaatgctggcattatgcattacccaccaacctaaagttgctcatatggtcgatgctgtc
gcggcaaaggcattacgagctcagcttcctgctgcgcttaatatccaagtgacaacgggt
aacgatgagcttctggcgttagtgacctcatcaaaggtcgataccattatggcggccatt
gttggcgctgctgggttagttccgactcttgctgccgttaatgcgggcaaacgagtattg
ctagccaataaagaagccttagttatgtcgggtgagttgtttatcgaggtgactaagcgt
tcaggcgcaactttactgcctgtagacagcgaacataatgcgatttttcaatgtttaccc
caagaggtacaggctaatcttggtcgttgtgatttagccgcatccggtatttcccatatt
ctgctaacgggttctggtggaccatttttacgttcagatttagcaacacttgcggccatg
acacccgcacaggcctgtaaacatcctaattggtctatgggacctaaaatctctgtcgat
tcggcgactatgatgaataagggattagagttcattgaggcgcgctggttgtttaatacg
caagctaaccaacttaaagtggttgttcatccgcagagtgttatccattcaatggtgcaa
tatattgatggctctgttattgcacaaatgggaaaccctgacatgcggacaccgattgcc
cattgcatggcctatccacaaagaattcactctggtgttgaacctttagattttttcaaa
gtcggacagttaagcttttatgaacctgattttgagcgttttccctgtttggcgctggct
atggcagcctgtgcccaaggccaagaggcgacaacggtactcaatgcggcgaatgagatc
gcggttgaggcttttttacaaggacaaataggctttacgcaaattgctaaagtgaatgaa
acttgcttagcattcgtcccgagtggaactatgaccagcattgaagatattatcgcgtta
gatacgcaaagtcgcatttatgcgcgggaaactttagctaagatcgcttaa

DBGET integrated database retrieval system