KEGG   Shewanella putrefaciens 200: Sput200_1400Help
Entry
Sput200_1400      CDS       T02015                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00040  Pentose and glucuronate interconversions
shp00052  Galactose metabolism
shp00500  Starch and sucrose metabolism
shp00520  Amino sugar and nucleotide sugar metabolism
shp01100  Metabolic pathways
shp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sput200_1400
   00052 Galactose metabolism
    Sput200_1400
   00500 Starch and sucrose metabolism
    Sput200_1400
   00520 Amino sugar and nucleotide sugar metabolism
    Sput200_1400
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sput200_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADV53865
UniProt: E6XRW0
Position
complement(1579461..1580369)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDDASCNLSKDNLAAMVELFDETQVGQIMVEGVPHNMVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKNVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttcccgcgaccaaagctattcccaaggaaatgctacccgttgttgataagccattgatt
cagtatgtcgtcagtgaagctattgcggctgggatcaaagaaattgtactcgtaactcat
gccagtaaaaactccatcgaaaaccatttcgataccagttttgaattagaagcccagcta
gaacgccgtgtaaagcgtcaactgctagaagctgttcagtctatttgtcctaaagatgta
actgtgatcagtgttcgccaatcccaggctaaaggtttaggtcatgctattttatgtgcc
aaatccgttgtaggtgacgctccttttgccgtattgctacctgacgtcatcatcgatgat
gcaagttgcaacctcagcaaagacaacttggctgctatggttgagctttttgatgagacg
caagtgggccagatcatggttgaaggtgtgccacacaacatggtcaaccaatacggtatt
gccgatgtgaatggccatgatttacaaccaggtgaatctgaaccattagtcgaactggta
gaaaaaccaccagtagatgaagcgccttctaacttagccgttgttggtcgttatgtatta
cctgccagcatctggccattactggccaaaacacctgcaggtgcgggcgatgaaatccaa
ttaacggatgcgattgcgatgttaatgaagcaagaaaccgtaaatgcttactacatggaa
ggtaagagccacgactgcggtaacaaacaaggttatatgcgtgctaacgttgagtatgcc
ctgcgccacagcgagatcggtgaagattttgcgcactatttaaaaaacgttgtaaaagga
attaaataa

DBGET integrated database retrieval system