KEGG   Shewanella putrefaciens 200: Sput200_1400Help
Entry
Sput200_1400      CDS       T02015                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sput200_1400
   00052 Galactose metabolism
    Sput200_1400
   00500 Starch and sucrose metabolism
    Sput200_1400
   00520 Amino sugar and nucleotide sugar metabolism
    Sput200_1400
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sput200_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1579461..1580369)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDDASCNLSKDNLAAMVELFDETQVGQIMVEGVPHNMVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKNVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttcccgcgaccaaagctattcccaaggaaatgctacccgttgttgataagccattgatt
cagtatgtcgtcagtgaagctattgcggctgggatcaaagaaattgtactcgtaactcat
gccagtaaaaactccatcgaaaaccatttcgataccagttttgaattagaagcccagcta
gaacgccgtgtaaagcgtcaactgctagaagctgttcagtctatttgtcctaaagatgta
actgtgatcagtgttcgccaatcccaggctaaaggtttaggtcatgctattttatgtgcc
aaatccgttgtaggtgacgctccttttgccgtattgctacctgacgtcatcatcgatgat
gcaagttgcaacctcagcaaagacaacttggctgctatggttgagctttttgatgagacg
caagtgggccagatcatggttgaaggtgtgccacacaacatggtcaaccaatacggtatt
gccgatgtgaatggccatgatttacaaccaggtgaatctgaaccattagtcgaactggta
gaaaaaccaccagtagatgaagcgccttctaacttagccgttgttggtcgttatgtatta
cctgccagcatctggccattactggccaaaacacctgcaggtgcgggcgatgaaatccaa
ttaacggatgcgattgcgatgttaatgaagcaagaaaccgtaaatgcttactacatggaa
ggtaagagccacgactgcggtaacaaacaaggttatatgcgtgctaacgttgagtatgcc
ctgcgccacagcgagatcggtgaagattttgcgcactatttaaaaaacgttgtaaaagga
attaaataa

DBGET integrated database retrieval system