KEGG   Shewanella putrefaciens 200: Sput200_1831Help
Entry
Sput200_1831      CDS       T02015                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00340  Histidine metabolism
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01230  Biosynthesis of amino acids
Module
shp_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Sput200_1831
Enzymes [BR:shp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sput200_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADV54286
UniProt: E6XJP9
Position
complement(2072526..2073827)
Genome map
AA seq 433 aa AA seqDB search
MEILTWSTLSAAEQKTALKRSPLIGDSGLEQSVRAILDAVATRGDAAIAEFNQKFDGFDS
AKIGELRMGETEIAAASARVSPELKAAIAKAMANIDVFHSAQQFRPIDMETEAGVRCELR
NEPIEKVGLYIPGGSAPLISTVMMLALPAKIAGCEQRVLVSPPPINDAIIYAANASGITE
IYQVGGAQAIAALAFGTETIPAVDKIFGPGNRYVTEAKRLVSQDGRCTVCIDMPAGPSEV
LVIADSDANCEFIAADLLSQAEHGPDSQVILVTDSQDIADGVNDALTRQLAALPRCDIAA
TALLSSRTFVVDDMQQAAQVSNQYGPEHLIIQTRFPREVLKNIRAAGSVFLGAYTPESVG
DYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLIGLGQAVMTLASNELLDAH
KNAVAIRLASLEK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaacttggtcaaccttatccgccgccgagcagaaaacggcgctgaaacgc
tcgcccttaattggtgatagtggcttagagcaaagcgttcgcgccattctcgatgcggta
gcgacgcggggtgatgccgccattgccgaatttaatcaaaagtttgatggctttgatagt
gctaagattggtgagctgcgcatgggcgaaaccgaaattgccgcggcaagcgcacgggta
tcgcctgagctaaaagcggcgatcgccaaagccatggcgaacatagacgtgtttcacagc
gcccagcaatttcgcccgattgatatggagaccgaggcgggagtgcgctgcgagctacgt
aacgaaccgattgaaaaagtgggtttatatattcctggtggcagtgcgccattaatttct
accgtgatgatgctcgccctgcccgccaagatcgccggctgcgaacaaagagtattagtc
agcccaccgcccatcaacgatgccattatctatgcagccaatgccagtgggatcactgag
atctatcaagtaggcggcgcgcaggccattgcggcgctggcctttggcacagaaacgatc
cccgcggtcgataaaatttttggtccaggtaatcgctacgtgacagaagctaaacgctta
gtatcacaggatggccgctgcactgtgtgtatcgatatgccagctggcccttctgaagtg
ttagtgattgccgatagcgatgccaattgcgaatttattgccgccgatttgctttcgcaa
gcggagcacggccctgattcacaagtgattttagtgacagattcgcaagatatcgccgat
ggcgtgaatgacgcgctaacaagacagctcgctgccctaccgcgttgtgatatcgcagca
acggcgcttctcagcagtcgcacttttgttgtggacgatatgcagcaagccgcgcaggtt
tctaatcaatatgggcctgagcacttgatcattcaaacgcgctttccccgtgaggtactg
aaaaacattcgcgccgcgggctcggtatttttaggcgcttatacacctgaatctgttggc
gattatgccagtggcaccaaccacgtgctaccgacttacggttacagccgcgccgtgtcg
agcctgtcattagccgattttagccgccgctttaccgtgcaggaactcagcgctaagggc
ttaatcggattggggcaagcggtcatgacgttagccagtaacgaattgctcgatgcgcac
aaaaatgccgttgccattcgtctagctagcctagagaaatga

DBGET integrated database retrieval system