KEGG   Shewanella putrefaciens 200: Sput200_1840Help
Entry
Sput200_1840      CDS       T02015                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shp  Shewanella putrefaciens 200
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sput200_1840
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sput200_1840
Enzymes [BR:shp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sput200_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2083708..2084736
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSVDVSEAEAEMLRHPQVGGLILFSRNFSSRDQLIRLVQQIRQIRPEILIAV
DHEGGRVQRFRDGFTLIPAMGDILPAAKGDMTLAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGISEVIGKRSFSADPSEVIALADSFIDGMAQAGMGAVGKHFPGHGSVAADSHIAQ
PIDERDAKAIFAKDILPFKELIAKGQLSGIMPAHVIYSKVDPHPAGFSHYWLKQVLRQEL
GFTGVIFSDDLGMKGAAFAGDYRARAQAALDAGCDMILVCNDNPGVMSLLDGFSWPENAP
LHPASLLKPNVNQTSLALENLARWENAKQLAEQICLAQKAKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttgatgttggatttgctgtctgtagatgtcagtgaggcagaagctgaaatg
ttacgccatccacaggtgggtggtttaattttattttcccgtaatttttcgagtcgtgat
cagttaatccgtctggtacaacagatacgccaaattcgcccagaaattctgatcgcggtc
gatcatgaaggtggtcgggtgcagcgttttcgagatgggtttactcttattcctgcaatg
ggggatattttacccgcggcgaaaggtgatatgacgttagctaagcgttgggcctgtgag
ttaggatttttaatggcaatagaattgctggcctgtgatatcgatttaagctttgcacct
gtacttgatcttaatggcattagtgaagtgatcggtaaacgaagctttagtgcggatcct
agcgaggttatcgcactggcagatagttttattgacgggatggctcaggcgggaatgggc
gcagtaggtaaacattttcccggccatggcagtgtggcggcggattctcatattgcccag
cctattgatgagcgtgatgcgaaggccatatttgctaaggatattttgccctttaaggaa
ttgattgctaaggggcaattatcgggcattatgcctgcccatgtgatttattctaaagtc
gatcctcatccagcgggattttcacattattggcttaagcaagtgttgcgtcaggaactt
ggttttactggggtgattttctccgatgatttagggatgaagggcgctgcatttgcaggg
gattatcgcgctcgagcccaagcggcccttgatgcagggtgcgatatgatcttagtctgt
aatgataatccgggtgttatgtcgttgcttgatggctttagttggcctgaaaatgcaccg
ttacatcctgcaagtttgttaaaacccaatgttaatcaaacttcactggcactagaaaat
ctggctcgttgggaaaatgcaaaacaattggcggaacaaatttgtttggcacaaaaggca
aaagtttga

DBGET integrated database retrieval system