KEGG   Shewanella putrefaciens 200: Sput200_1898Help
Entry
Sput200_1898      CDS       T02015                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:shp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sput200_1898
Enzymes [BR:shp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sput200_1898
DNA repair and recombination proteins [BR:shp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sput200_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 AAA_22 UvrD_C DUF2075 UvrD-helicase AAA_16 SRP54 AAA_28 ResIII Zeta_toxin DEAD T2SSE NTPase_1 PhoH PIF1 Flavi_DEAD AAA_29 CbiA NACHT
Motif
Other DBs
NCBI-ProteinID: ADV54354
UniProt: E6XKG6
Position
complement(2144603..2146663)
Genome map
AA seq 686 aa AA seqDB search
MMRSTFGLNAHAHSAEHWVDYGAIQLTAPLADLLKQWEQERLITSLDRHFALQMSQLHQG
DSQNPLFILLCALLSQQLSSQHSCLVLAHIVPLNPMAEQVSHCKITLSLDELTSILQTFD
AVGQAGSNKPLIIENGRLYLQRYHQFETAVATSLIQLSAQTNTVKVEDLKSHLDQLFPAN
NAEIIDWQKVATATALGKKLAIITGGPGTGKTTTVTKLLLLLQLESNQTIRLVAPTGKAA
ARLSESIKASKARLAKELSLNQSDNSQAIFLTALSRIPEEASTLHRLLGVIPNSPQFRHH
QGNPLRLDLLIVDEASMVDLPMMYKLLNALPEHASLILLGDQDQLASVEAGAVLADICAG
LKLPMPQGGTQESLWQMRYSLEQATQLSILTGYDLTPFISQSPKMGDSLCMLMHSHRFKG
DAGIGLLASAVNRADLQGILQVWRQGFAELNWLEHSTHLSQTQAKISEPAHNTGLNLLLE
QACAQYGDYLGLLNQDIGNRPSTAEIIERFNHYRILCAMRSGDYGVEGINSYVTQALTHA
KLIKPQQEFYLGRPIIIQSNDYNLGLFNGDIGLILQDEDKPERLMAHFIKADGGLLKVLP
ARLPKHETCYAMTVHKSQGSEFNRVALVLPPSPSLAQWQLLTKELIYTAITRAKAHFTCL
GTQQVFERASSQVTQRASGLADRLWG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctcaacattcggcttaaatgcgcacgctcattcagcggagcattgggttgac
tatggcgccatccaacttacggcgccactagctgatttactcaaacagtgggagcaagag
cgattgataacatcgctcgatcggcattttgcactacaaatgagtcagttacatcaaggt
gatagccaaaatcccctgtttatcttactctgtgcgctgttgagccaacagttatcttca
cagcatagttgcttagtacttgcccatatcgtgcctctcaaccccatggcagagcaagtc
agtcattgtaaaatcacattaagccttgatgaattaactagcattctgcaaacctttgat
gccgtgggccaagctggcagcaataaacccctgattatcgaaaatggcagactctactta
cagcgttatcatcagtttgaaactgctgttgccacctcgttaattcaattatccgcacaa
accaatactgtaaaagttgaggatcttaaaagtcacttagatcagttattccctgccaac
aatgccgaaataattgattggcaaaaagtggcaacggccaccgcgcttggcaaaaagctg
gcgattatcaccggtgggcctggcacaggtaaaaccacaacggtgactaagctattatta
ttgttgcaattggaatcaaaccaaacgatccgcttagtcgctcctacgggaaaagccgcg
gcgcgcttaagtgaatccattaaggcctcaaaagcccgccttgcgaaagaactgagcctt
aatcaaagtgacaatagccaagcgatatttttaaccgcactcagccgaataccagaagag
gcctctactttacaccgactacttggggtcattcctaattcacctcagtttcgccaccat
caaggtaatccgttaaggctcgacttattgatcgtggatgaagcctcgatggtagattta
cctatgatgtataagttgttaaatgccctaccagagcatgccagtttgattttactgggc
gatcaagatcagttggcttccgttgaagcgggtgctgtacttgcagatatttgtgcaggt
ttaaaactgcctatgccgcaaggaggtacacaagaatcactttggcaaatgcgctattcg
ctcgaacaggccacacaactcagtatattgacaggctatgacttaacaccatttatcagc
cagtcccccaaaatgggcgatagtttatgtatgttaatgcatagccataggttcaaaggg
gatgcgggcataggactccttgcaagtgcagttaatcgcgctgatcttcaagggattcta
caggtgtggcgccaaggatttgcggagcttaactggttagaacacagtactcatctaagc
caaacccaagctaaaatcagtgaacctgcacacaacactgggcttaacttactgcttgaa
caagcatgcgcacaatatggcgattacctcggtttattaaatcaggatatagggaatcgt
cctagcaccgcagaaattatcgagcgttttaaccactaccggattttatgcgccatgcgc
tcgggtgattatggggtagaaggtattaacagctatgtcacccaagcgctcacccatgcc
aaacttatcaaaccacaacaggagttttatttaggccgcccgattattatccaaagtaat
gactataacttaggcttgtttaacggggatatcggactaattctacaggatgaagataaa
cccgaacgcctaatggcacactttattaaggccgacggtggtctgcttaaagtcttacct
gcacgtttaccaaagcatgaaacctgctacgcgatgacagtgcataaaagccaagggagt
gaatttaatcgcgtggctttagtgctaccaccgagtccaagcttagctcagtggcaacta
ttaactaaagaattaatttatacagcaattacccgcgcgaaagcacattttacttgctta
ggcacccagcaagtttttgagcgagccagcagccaagtcacccaaagggcatcgggtctt
gccgatagactttggggttaa

DBGET integrated database retrieval system