KEGG   Shewanella putrefaciens 200: Sput200_1914Help
Entry
Sput200_1914      CDS       T02015                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
shp  Shewanella putrefaciens 200
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2171980..2173086
Genome map
AA seq 368 aa AA seqDB search
MLPHIQIRSVELTYVIQKINNNMVSIFMFSVENKELDSAAQILRLAVPQMSALDIPVTPE
NYTVWYEYFAGTNLDLNRAIDGFIANGVVFTKEVNTSLYKNFIQEQSPEVIENVQIETQI
LINSLLCKIVQLNQGTADFSGTLAEFGIKLQSHSDINTLNQLVDGVMDEMQSLLINNQNM
EQSLNAMGQEVQHLKSEMENLSLAAMTDQLTSLYNRRAYEIAIQDHIHRAQEQHSRCSLL
IVDIDRFKQFNDTYGHQIGDKVLAYVALALKQCVRGDDFVARYGGEEFVVLLPNTHFHDA
LQVAETLRERISERHLTIGKDKKLSLGAITVSIGLASLQEGDDAETLFSRADKALYEAKS
DGRNCVRG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccatatccaaattcgatcagttgagctaacttatgttatacaaaaaattaac
aataatatggtttcaatatttatgttttctgttgaaaataaagaacttgattccgcggcg
caaattttgcggctagccgtgccacaaatgtcggcccttgatatccccgttaccccggaa
aactatacggtttggtatgaatattttgcggggactaatcttgacttaaaccgtgcgatt
gatggttttatcgcaaacggtgttgtgtttacaaaagaggttaatacaagcttatataaa
aattttatccaagaacaatcccccgaggtgattgagaatgtgcaaatagagactcagatt
ttaatcaattcattactgtgcaaaattgtacaattgaaccaagggaccgcggatttttcg
ggcactttagcggaatttggcatcaagcttcaatcccattctgacattaataccttaaat
caacttgttgatggtgtgatggatgaaatgcaaagtttactgatcaacaaccaaaacatg
gaacaaagcctaaatgccatggggcaagaggtacaacatcttaagtcggaaatggaaaat
ttaagtctggcggccatgacggatcaattaacctctttatataatcgccgcgcctatgaa
attgccattcaagaccatattcaccgcgcccaagaacagcattcccgttgtagcttactg
attgttgatatagataggtttaaacaatttaatgatacctatggtcatcaaattggcgat
aaagtattagcttatgtcgcactcgccttaaagcaatgtgttcgaggtgatgactttgtt
gctcgctatggtggcgaagagtttgtagtgcttttgccaaatacccattttcacgatgct
ttacaagttgcggaaaccttaagagaacgtatttcagagcggcacttaaccataggtaaa
gataaaaaattatccctcggcgcaattacagtatcgatcggtcttgcctcattacaagag
ggtgatgatgccgaaacgctctttagccgagcggataaagccttatatgaagctaaatcc
gatgggcgtaactgtgttaggggatag

DBGET integrated database retrieval system