KEGG   Shewanella putrefaciens 200: Sput200_1914Help
Entry
Sput200_1914      CDS       T02015                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
shp  Shewanella putrefaciens 200
Brite
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sput200_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2171980..2173086
Genome map
AA seq 368 aa AA seqDB search
MLPHIQIRSVELTYVIQKINNNMVSIFMFSVENKELDSAAQILRLAVPQMSALDIPVTPE
NYTVWYEYFAGTNLDLNRAIDGFIANGVVFTKEVNTSLYKNFIQEQSPEVIENVQIETQI
LINSLLCKIVQLNQGTADFSGTLAEFGIKLQSHSDINTLNQLVDGVMDEMQSLLINNQNM
EQSLNAMGQEVQHLKSEMENLSLAAMTDQLTSLYNRRAYEIAIQDHIHRAQEQHSRCSLL
IVDIDRFKQFNDTYGHQIGDKVLAYVALALKQCVRGDDFVARYGGEEFVVLLPNTHFHDA
LQVAETLRERISERHLTIGKDKKLSLGAITVSIGLASLQEGDDAETLFSRADKALYEAKS
DGRNCVRG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccatatccaaattcgatcagttgagctaacttatgttatacaaaaaattaac
aataatatggtttcaatatttatgttttctgttgaaaataaagaacttgattccgcggcg
caaattttgcggctagccgtgccacaaatgtcggcccttgatatccccgttaccccggaa
aactatacggtttggtatgaatattttgcggggactaatcttgacttaaaccgtgcgatt
gatggttttatcgcaaacggtgttgtgtttacaaaagaggttaatacaagcttatataaa
aattttatccaagaacaatcccccgaggtgattgagaatgtgcaaatagagactcagatt
ttaatcaattcattactgtgcaaaattgtacaattgaaccaagggaccgcggatttttcg
ggcactttagcggaatttggcatcaagcttcaatcccattctgacattaataccttaaat
caacttgttgatggtgtgatggatgaaatgcaaagtttactgatcaacaaccaaaacatg
gaacaaagcctaaatgccatggggcaagaggtacaacatcttaagtcggaaatggaaaat
ttaagtctggcggccatgacggatcaattaacctctttatataatcgccgcgcctatgaa
attgccattcaagaccatattcaccgcgcccaagaacagcattcccgttgtagcttactg
attgttgatatagataggtttaaacaatttaatgatacctatggtcatcaaattggcgat
aaagtattagcttatgtcgcactcgccttaaagcaatgtgttcgaggtgatgactttgtt
gctcgctatggtggcgaagagtttgtagtgcttttgccaaatacccattttcacgatgct
ttacaagttgcggaaaccttaagagaacgtatttcagagcggcacttaaccataggtaaa
gataaaaaattatccctcggcgcaattacagtatcgatcggtcttgcctcattacaagag
ggtgatgatgccgaaacgctctttagccgagcggataaagccttatatgaagctaaatcc
gatgggcgtaactgtgttaggggatag

DBGET integrated database retrieval system