KEGG   Shewanella putrefaciens 200: Sput200_1950Help
Entry
Sput200_1950      CDS       T02015                                 

Definition
L-arabinose-specific 1-epimerase (mutarotase), AraM (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shp00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2220134..2221228
Genome map
AA seq 364 aa AA seqDB search
MLRKLIIKGESTHMSLSISTQKLTHSAFPAPLELITLTNSHGLEVVLSSYGASIWSVKLY
GKEDKTIDLSLSYQNIQDWAINPYYFGITAGRVANRIGGAAFSLKGQTIVLTPNEGNNQL
HGGPQGLSHCVWQCETKQYSDAVGAIFRIQSPDGDQGYPGDLSVTVEYRLSESNELILIY
DALSDQTTPVCLTNHAYWNLASDKQHGILGHNLQLNASHILALDSEQIPTGELVLVDDTP
FDFRQIKSISEDIHKLSNGYDHYFVMSKDIDNTSCLKTIATLIEPISGRELEISTTELGV
QFYSGNFLDGTRLDNHGKPLNQYQGLCLETHGYPNAVNIAHFPSVMLEANKPYKQITVHR
FKNI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagaaaacttattataaaaggtgaaagcactcatatgtcactctcaatctctaca
caaaaattaacacatagtgcctttcctgcaccattagagttaataacattaacgaatagt
catggtttggaagtagtgttatcgagttatggtgcaagtatttggtctgtcaaactctat
ggaaaagaagataaaaccattgatctcagtttgagctatcagaatattcaagattgggca
ataaacccttattattttggtattactgcaggccgcgttgcaaatcgaattggtggagcg
gcattttctttaaagggtcaaaccattgtattaaccccgaatgaaggtaataaccaactt
cacggtggtccgcaaggcttaagtcactgtgtttggcaatgtgaaactaagcaatattcc
gatgctgttggtgccatctttaggatacagagtcctgatggtgatcaaggttatcctgga
gatttatccgtaacagtcgaatatcgccttagcgaaagcaatgagttaatcctgatttac
gatgctctatcagaccaaactactccggtttgtctcacaaatcatgcctattggaatctc
gcatctgacaagcaacatggcatcttaggccataacttacaactcaatgcgagtcatatt
ttagccttagattctgagcaaattcctacgggtgaattggttttagtcgatgataccccc
ttcgattttcgtcaaataaaatccatatctgaagatattcataaattaagtaatggttat
gaccactattttgtgatgtcgaaggatatagacaatacctcatgcttaaaaaccatcgcc
acattaatcgaacctatttcaggacgtgaattggaaatcagtaccacagaattaggtgtg
caattttatagtggtaattttttggatggtacgcggcttgataatcatggaaaaccgtta
aatcaatatcaaggtttatgtttagaaacccatggttatcctaatgccgtcaatattgct
cattttccgagtgttatgttagaggcaaataaaccctataaacaaataacggtgcataga
tttaaaaatatttaa

DBGET integrated database retrieval system