KEGG   Shewanella putrefaciens 200: Sput200_1950Help
Entry
Sput200_1950      CDS       T02015                                 

Definition
L-arabinose-specific 1-epimerase (mutarotase), AraM (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sput200_1950
   00052 Galactose metabolism
    Sput200_1950
Enzymes [BR:shp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sput200_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2220134..2221228
Genome map
AA seq 364 aa AA seqDB search
MLRKLIIKGESTHMSLSISTQKLTHSAFPAPLELITLTNSHGLEVVLSSYGASIWSVKLY
GKEDKTIDLSLSYQNIQDWAINPYYFGITAGRVANRIGGAAFSLKGQTIVLTPNEGNNQL
HGGPQGLSHCVWQCETKQYSDAVGAIFRIQSPDGDQGYPGDLSVTVEYRLSESNELILIY
DALSDQTTPVCLTNHAYWNLASDKQHGILGHNLQLNASHILALDSEQIPTGELVLVDDTP
FDFRQIKSISEDIHKLSNGYDHYFVMSKDIDNTSCLKTIATLIEPISGRELEISTTELGV
QFYSGNFLDGTRLDNHGKPLNQYQGLCLETHGYPNAVNIAHFPSVMLEANKPYKQITVHR
FKNI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagaaaacttattataaaaggtgaaagcactcatatgtcactctcaatctctaca
caaaaattaacacatagtgcctttcctgcaccattagagttaataacattaacgaatagt
catggtttggaagtagtgttatcgagttatggtgcaagtatttggtctgtcaaactctat
ggaaaagaagataaaaccattgatctcagtttgagctatcagaatattcaagattgggca
ataaacccttattattttggtattactgcaggccgcgttgcaaatcgaattggtggagcg
gcattttctttaaagggtcaaaccattgtattaaccccgaatgaaggtaataaccaactt
cacggtggtccgcaaggcttaagtcactgtgtttggcaatgtgaaactaagcaatattcc
gatgctgttggtgccatctttaggatacagagtcctgatggtgatcaaggttatcctgga
gatttatccgtaacagtcgaatatcgccttagcgaaagcaatgagttaatcctgatttac
gatgctctatcagaccaaactactccggtttgtctcacaaatcatgcctattggaatctc
gcatctgacaagcaacatggcatcttaggccataacttacaactcaatgcgagtcatatt
ttagccttagattctgagcaaattcctacgggtgaattggttttagtcgatgataccccc
ttcgattttcgtcaaataaaatccatatctgaagatattcataaattaagtaatggttat
gaccactattttgtgatgtcgaaggatatagacaatacctcatgcttaaaaaccatcgcc
acattaatcgaacctatttcaggacgtgaattggaaatcagtaccacagaattaggtgtg
caattttatagtggtaattttttggatggtacgcggcttgataatcatggaaaaccgtta
aatcaatatcaaggtttatgtttagaaacccatggttatcctaatgccgtcaatattgct
cattttccgagtgttatgttagaggcaaataaaccctataaacaaataacggtgcataga
tttaaaaatatttaa

DBGET integrated database retrieval system