KEGG   Shewanella putrefaciens 200: Sput200_2293Help
Entry
Sput200_2293      CDS       T02015                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shp  Shewanella putrefaciens 200
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sput200_2293
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sput200_2293
  Amino acid metabolism
   00310 Lysine degradation
    Sput200_2293
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sput200_2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2613542..2614744)
Genome map
AA seq 400 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEHVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVAGQEVTKAQAEAAAPVAETSDESNDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVSSASKGAPKASAPAAPAVAPLAEGRSEKRVPMTRLR
KTIANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEA
LKRFPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMSLAEIEKAVRDLAIK
GRDGKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEIL
PMMYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgctacgattgcc
acttggcacgttaaagtgggtgagcatgtttctcgtgatcaaaatcttgttgatattgaa
acagataaagttgtactcgaagtggttgcacctgaagatggccacattggtgagtttctg
ttccaagaaggcgataccgtacttggtgaacaagtgattgctaagttcatcgcgggggct
gttgctggtcaagaagtcactaaagcccaagctgaagcggcagcaccggttgctgaaaca
agcgatgaaagtaatgatgcgttaagtccatctgtacgccgtttactggcagagcacaat
gttgatgctagcaaagtgaaaggtacaggtgtaggcggtcgtatcactaaagaagacgtt
gaagcttttgttagctctgcatcaaaaggggcgcccaaagcatcggctcctgcagcacct
gccgttgcgccattagcagaaggccgtagtgagaaacgtgtacctatgacacgtttacgc
aaaactatcgctaaccgtctattagaagcgaaaaactctaccgctatgctcacgacgttc
aacgaagtgaacatgaagcccatcatggatatccgtaagcagtaccaagatatctttgaa
aagcgccacggcatccgtttaggttttatgtctttctatgtgaaagcggtgacagaagcc
ctgaaacgcttcccagaagtgaacgcatcaatcgatggtgatgatattgtttatcacaat
tatttcgatattagcattgctgtatcaacaccacgtggtctggtaacacctgtcttacgt
gacacagatactatgagtcttgctgaaattgaaaaagcagtacgcgatctcgctatcaaa
ggccgtgatggcaaactgacggttgccgatatgactggtggtaacttcaccgtgactaac
ggcggcgttttcggttcactgatgtctacaccgatccttaacctgccacaaagtgcgatt
ttaggcatgcatgccattaaagatcgtccaatggcagtcaatggtcaggttgaaatcctg
cccatgatgtacctagcactctcatatgaccatcgtattgttgatggccgtgagtctgtt
ggtttcttggttgcgattaaagacttcctagaagacccaacacgtctgctgctcgatctt
taa

DBGET integrated database retrieval system