KEGG   Shewanella putrefaciens 200: Sput200_2326Help
Entry
Sput200_2326      CDS       T02015                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
shp  Shewanella putrefaciens 200
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:shp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2655170..2655769)
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGLKLASALSSAMSDVGHCQSC
RTYTEETLCPICASHKRGSSSTICVVETPADVLAIEAGGHFTGRYFVLLGHLSPLDGVGP
EELGLALLERHLASGDVSELILATNPTVEGEATAHFIADMARRHKVMISRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagtccactgcttgacgagttaattcaatccctgcgttgtttacctggggtc
ggacctaaatcggcacaacgtatggcgtttcaattgcttgaacgggacagaaaagcaggg
cttaaattagccagtgcactgtccagtgccatgagtgatgttggccactgtcagtcttgc
cgaacttatactgaagaaacgctgtgccccatttgtgctagccataaacgcggctcatct
tccaccatttgtgtagtggaaacgcctgccgatgtgttggctattgaggcgggtggacat
ttcacaggccgttattttgtactacttggccatttatctccccttgacggtgttggccct
gaagaattagggctggctttactcgagcgtcatttagcctcgggggatgtcagtgagttg
attctagcaaccaacccaacggtagaaggtgaagcgacagcgcattttattgccgatatg
gcaagacgtcataaggtgatgatcagccgtattgcccacggtgttcccgttggcggtgag
cttgaatatgtggatagcaccacgttggcactctcatttaatgggcgtttgccgttgtaa

DBGET integrated database retrieval system