KEGG   Shewanella putrefaciens 200: Sput200_2375Help
Entry
Sput200_2375      CDS       T02015                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:shp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shp00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:shp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:shp00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:shp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2711096..2713048
Genome map
AA seq 650 aa AA seqDB search
MSSQSLYKVSGNIAANALVNNEQYKTMYQESIVNPEGFWREHGKRIDWIKPYTKIKKTSF
DDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGDNASEQRKITYGELHADVCKF
ANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGGVHSVVFGGFSPDSIASRVIDGKS
KVVITSDEGMRGGRAIPLKRNIDDALNHPDVTSVEKVIVLKRTGGKIDWVEGRDVWWHSL
LETASEHCQPEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKAGEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVNILYTAPTL
IRALMAEGKQHFDQFDGSTLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGENEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
LVAEAAVVGYPHDIKGQGIYAYVTLTRGTEESEELRQELRQWVRKEIGALATPDLIQWAS
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRTE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcagtctctctacaaagtctccggcaatatcgctgccaatgcacttgtaaat
aacgaacaatataaaacaatgtaccaagagtcgattgtcaacccagagggtttctggaga
gagcacggcaaacgcattgactggataaaaccctatacaaagatcaaaaaaacctctttt
gacgatcataatttgtcaattaactggttttacgatggcaccctgaatgcttctgccaac
tgtttagatcgtcatttagccgaacacagtgatcgcgtggcgattatttgggaaggtgat
aacgccagcgaacaacgcaaaatcacctacggagaattacatgcagatgtgtgtaagttt
gccaacgcactgcgcagtcaaggcgtgcgccgtggtgacatagtcaccatttacatgcca
atggtgccagaagccgccgttgctatgcttgcttgcgcacgcattggcggggttcattca
gtcgtatttggtggcttctcacctgactctatcgcctcccgtgtgatcgatggcaaatca
aaagtggtgatcacctctgatgaggggatgcgcggtggccgagccattccgctaaagcgt
aatatcgatgacgcgctcaatcatcccgatgtcactagcgtagaaaaagtcatcgtcctt
aaacgtacaggtggcaaaatcgactgggttgaaggccgtgatgtttggtggcacagctta
cttgaaaccgcatcggagcactgccagccagaagaaatgggcgccgaagacccactgttt
ttactctatacctcaggctctaccggtaatcctaaaggtgttttacataccactggtggt
tacatggtttatgcgtcgatgacccatgaatatgtctttgattataaagccggagaagtg
tactggtgtacggctgatgtaggttggatcacgggccactcatatatggtttacggtcca
ctcgccaatggtgccactgtacttatccatgaaggcgtgcccaatcatccaagccccgct
cgacttggtgagatgattgaccgtcataaggtcaatatcctttacaccgcaccgacgttg
atccgtgcattaatggccgaaggcaaacagcattttgatcaattcgatggaagtacactg
cggatcatgggctcagttggcgaacctatcaatccagaagcatggcgttggtatcacgaa
gtcattggtcacgagcattgtccgattgtcgatacttggtggcaaaccgagactggcggt
attttaataacgccactgccgggtgcgacggacacaaaaccgggatcagccacccgtcca
ttctttggcgtacaacccgccctagtcgataacatggggaatattttagagggtgagaat
gaaggtaacttagtcttactcgattcttggccaggccaaatgcggactgtgtatggcgat
cacgaacgattcgtgctgacctactttaaaaccttccgcggcatgtattttaccggtgat
ggtgcccgtcgcgatgaagacggttactactggatcacagggcgtgtcgatgacgtcatt
aacgtctctggacaccgtttaggtaccgctgaagtggaaagtgcattggtatcccatgaa
ctggttgctgaagccgctgttgtgggctatccacacgatattaaaggccaaggtatctat
gcctacgtcacgctaacccgtggaacagaagaaagtgaagagctacgccaggaactgcgc
caatgggtgcgtaaagagattggtgcattagcaactccagacctcatccaatgggcaagt
ggattacctaaaacccgttcaggcaaaattatgcgccgcttcctacgtaagattgctgct
aacgaagtcaccaatctaggtgatgcatcaaccttagccgatccagcggttatcgaaacc
ttgattgaaacccgtttaaatcgtacagaataa

DBGET integrated database retrieval system