KEGG   Shewanella putrefaciens 200: Sput200_2419Help
Entry
Sput200_2419      CDS       T02015                                 

Definition
multifunctional thioesterase/protease/lysophospholipase L1, TesA (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
shp  Shewanella putrefaciens 200
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:shp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2777028..2777627
Genome map
AA seq 199 aa AA seqDB search
MAKTLGAFILLSMLMATPVHAAKVLILGDSLGASYGMSEQLGWVAMLQKNLPEHQFINGS
VSGETTAGGLRRLPALLDSVSPDLVVVELGGNDGLRGFPPTQLENNLIQIITLAQKSGAK
VLLTEIMVPPNYGPRYTQKFTQVYQDISKTQNIELIPFFMQEIAPYPDLMQRDGIHPNEK
AQAKIAAWMQPWIEKALNQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaccctgggggcattcatcctactgagtatgttaatggctacgccagttcat
gcggcgaaggtactgatccttggcgatagcttaggcgcaagctatggcatgtcggaacaa
ctgggctgggtcgcaatgttgcaaaaaaatctccctgaacatcagtttattaatggttca
gttagcggagaaactaccgcaggcggccttcgccgattacccgctttactcgattctgtc
tctccagatcttgtggtcgttgaactgggagggaatgatggtttacgtggattcccacca
acgcaactcgaaaataatctaatccaaatcattactctagcgcaaaaaagtggcgccaaa
gtattactcaccgaaatcatggtaccgcctaactatggccctcgctatacccaaaagttc
acccaagtgtatcaagacatatccaaaacacagaatattgaattaattccattctttatg
caggaaatcgctccttatccagacttaatgcaacgggatggcattcatcccaatgaaaag
gcccaagcaaaaattgccgcatggatgcaaccttggatagaaaaagccttaaaccaataa

DBGET integrated database retrieval system