KEGG   Shewanella putrefaciens 200: Sput200_2435Help
Entry
Sput200_2435      CDS       T02015                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sput200_2435
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sput200_2435
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sput200_2435
Enzymes [BR:shp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sput200_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2795363..2796553
Genome map
AA seq 396 aa AA seqDB search
MSTLKLNPYFGEYGGMYVPQILVPALKQLETAFVEAQEDEDFKAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNATGRARYESATDDEALEAFQQLARCEGIIPALESAHAIAYAV
KMARECTKETILVVNLSGRGDKDIFTVSDILNGKEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgttaaagcttaacccttatttcggcgaatacggcggcatgtatgtgccacag
attttagtgccagcccttaagcaattagaaactgcctttgtggaagcgcaggaagatgaa
gactttaaagccgagtttaccgatttactgaagaactacgcgggtcgcccaacggcactc
accttaactcgcaatttaagcccaaatcctatggtgaaaatctaccttaaacgggaagat
ttactccacggcggcgcccataaaactaaccaagtgttaggccaagccctgctggctaag
cgcatgggtaaaaaagaaattattgcagaaactggtgcaggacaacacggcgttgccacc
gcccttgcctgcgcgctgttaggcttaaaatgtaaagtctatatgggtgccaaagatgtt
gcgcgccaatcacctaacgtatttagaatgcgtttgatgggcgcggaagtcattcctgtg
acctcaggttctgccaccctaaaagatgcctgtaacgaggcgatgcgcgactggtctggc
agctacgaaaaggcccactatcttctgggcaccgctgcggggccacatccgttcccaaca
atcgtgcgtgaattccaacgcattattggcgaagaaaccaagaagcaaatgctggaacgt
gaaggtcgcttgcccgatgctgttatcgcttgtgttggcggcggttcgaacgctatcggt
atgtttgctgactttatcgacgaacccagtgtcgaactgattggtgtcgaacctgcgggt
aaaggcatagacacaccaatgcacggcgcgccgcttaaacacggtaagactggtattttc
ttcggcatgaaagcgcctttgatgcaagacagcgaagggcaaatcgaagaatcttactcg
atttcagccggattggacttcccctccgttggcccgcagcacgcgcatctcaatgccact
ggccgcgcccgttatgaatcggctaccgatgatgaagccttagaagccttccaacaactg
gcgcgctgtgaagggattatccccgcattagaatcggcgcatgctatcgcctatgccgtg
aaaatggcgcgcgagtgcaccaaggaaaccattttagtggtcaatctttccggtcgtggc
gacaaagatattttcaccgtttctgacattttgaatggtaaagaggtataa

DBGET integrated database retrieval system