KEGG   Shewanella putrefaciens 200: Sput200_2436Help
Entry
Sput200_2436      CDS       T02015                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sput200_2436
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sput200_2436
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sput200_2436
Enzymes [BR:shp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sput200_2436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2796559..2797380
Genome map
AA seq 273 aa AA seqDB search
MSDTLTNTSLYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADALELGFP
FSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFANGIDA
FYAKAQQAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADSETLEQVSKSGEGY
TYLLSRAGVTGTDTKAGVPVEEILSKLKAFNAPPPLLGFGIAEPSQVSAAIKAGAAGAIS
GSAVVKIIETHQHDEVKLLATLGEFTRAMKAAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacacaagcctttaccaagccacctttgccaaactcaaggcc
gaaggccgtggcgcttttgtccccttcgtcacccttggcgatcctagccctgagttatcg
ctaaaaattatcgataccttagtacaaaacggtgccgatgccttagaactgggctttccg
ttttccgatcccttggccgatggcccagtgatccaaggcgctaacctgcgttctttagcc
gcaggcacgactccaacggcgtgttttgaattactggcacaagtgcgtgcaaaatatcct
gaactgccaatcggtttgctgctgtatgcgaacttggtgtttgctaatggcatagatgcg
ttttacgccaaagcgcagcaagcgggtgtggattcagtgcttatcgccgatgtgccagtg
gaagaatcagcgccctttagcgaagccgctaaagcccatggtattgcgccgatttttatc
gcgccgcccaatgccgacagtgaaacccttgagcaagtgagtaaaagtggtgaaggttac
acctatctcttatcccgcgcgggagtcacaggcacagacacgaaagctggcgtgccggta
gaggaaattttatctaaattaaaagcctttaacgccccgccaccgctcctcggttttggt
attgccgagccttcacaggtaagcgccgccatcaaagcgggcgctgcaggggcgatttct
ggctctgccgtagtaaaaatcatcgaaacccaccagcacgatgaagttaagctacttgca
acgcttggggaatttactcgcgcaatgaaggctgcgacctaa

DBGET integrated database retrieval system