KEGG   Shewanella putrefaciens 200: Sput200_2535Help
Entry
Sput200_2535      CDS       T02015                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sput200_2535
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Sput200_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2922102..2922680)
Genome map
AA seq 192 aa AA seqDB search
MAQLYFYYSSMNAGKSTSLLQSSYNYRERGMHTLVMTASIDDRYGKGKVASRIGIETDAQ
VFSSQDNLTEMIQAVHQVTPLSCVLLDECQFLSKEQVKQLTYVVDKLDIPVLCYGLRTDF
QGELFSGSHYLLAWADKLVELKTICHCGRKANMVVRLDDEGKVMREGEQVAIGGNERYES
VCRKHFREFIWD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggcacaactgtatttttactattcgtcaatgaatgcgggcaaatccacgtcattattg
caatcttcttataattatcgcgaacgtggtatgcataccttagtgatgacagcctctatt
gatgatagatatggcaaaggtaaagtggcctcccgtattggtattgaaacggatgcacag
gtttttagtagccaagataatctgactgaaatgatccaagccgtgcatcaagttacgcca
ttaagttgtgttttattggatgaatgccagttcttaagtaaagaacaagtaaaacagttg
acttatgttgttgataagctagatattccagtgttgtgctatgggctgcgaacagacttt
caaggtgaactttttagtggtagtcattatttgttggcttgggccgataagttagtcgag
ttaaagacgatttgtcattgtggacgtaaagcaaatatggtggttcgtcttgatgatgaa
ggtaaagtgatgcgtgaaggtgagcaagtggctatcggtggtaatgagcgttatgaatca
gtgtgtcgcaagcattttcgtgaatttatctgggattag

DBGET integrated database retrieval system