KEGG   Shewanella putrefaciens 200: Sput200_2870Help
Entry
Sput200_2870      CDS       T02015                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sput200_2870
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sput200_2870
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sput200_2870
Enzymes [BR:shp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sput200_2870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3236804..3238087)
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGKDRGLFFPSQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDELVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
SSDFDACQDLVKRAFDDPEVRDGLSLNSANSINISRLLAQICYYFEAVAQSKQRHEADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLDNGQWQPNPTQATMSNAMD
VSEPSNWPRVEAICEKLGWPLSNLVGIRLSEEQTSQALVELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELNLNLPLPVELEAVANKPILSAELAPDFIELKA
HLFKVLV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagctttaaagaagcggtacaa
ctggggttaggtaaagacagaggtttgttctttcctagtcaaatacccgtactagacgat
attgaagggctgctggcgttaccattcgttgagcgcagtaaaaaagtactcggcgcatgg
cttgcctctgagttaggccaagatgcggtcgatgaattagttgagcgtgcctttaacttc
gatttacctttggttgccgtcgatgagcagcgcgcttgcctcgaattattccacggtcca
acactggcgtttaaagattttggggcgcgttttatggcgcaatgcgttaatgcctttgtg
ggcgacacgcgtttaaccattttgactgcgacctcgggcgacactggcgcagcggttgcc
gatgccttctatgggcttgagaaagtcaatgtggtggtgctctatcctaagggcaagatc
agtgagctgcaggaaaagatgttcacgacgttgggcaagaatatccatacagtcgccgtc
tcgtccgatttcgatgcctgccaagatctcgttaagcgcgcctttgatgatccagaagtc
cgtgatggtctgagcttgaattcggctaactctatcaatatcagccgcttactcgcgcaa
atttgctattactttgaagcggttgcccagtctaaacaacgccatgaagccgatcctgtg
atttcagtgccaagtggtaactttggcaatctcaccgcaggtttattcgctaaagccatg
ggattaccggttaaacgctttatcgctgcgaccaatgccaacgatacagtgccgcgttat
ttagacaatggccaatggcagcccaatccgactcaagcgactatgtccaatgccatggat
gtgagtgagcccagtaattggccgcgagtggaagccatttgtgagaaattaggctggcca
ctgagtaatttggttgggatccgtttatcggaggaacaaacgtcacaggcgctggtcgag
ttacacgctcaaggttatgtgtctgagcctcacgcggcgattgcggctaaggcgttatct
ttaaccttagtgcccgatgaagtgggaatattcctcgggactgcccatcctgctaaattt
aaggatgtagtggatagggagttaaatcttaacttaccgctaccagtcgagcttgaagct
gttgccaataagcctatcttatcggcggaattagcacctgattttatcgaattaaaagca
catctatttaaagtattggtttaa

DBGET integrated database retrieval system