KEGG   Shewanella putrefaciens 200: Sput200_2870Help
Entry
Sput200_2870      CDS       T02015                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:shp01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:shp00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:shp00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3236804..3238087)
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGKDRGLFFPSQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDELVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
SSDFDACQDLVKRAFDDPEVRDGLSLNSANSINISRLLAQICYYFEAVAQSKQRHEADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLDNGQWQPNPTQATMSNAMD
VSEPSNWPRVEAICEKLGWPLSNLVGIRLSEEQTSQALVELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELNLNLPLPVELEAVANKPILSAELAPDFIELKA
HLFKVLV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagctttaaagaagcggtacaa
ctggggttaggtaaagacagaggtttgttctttcctagtcaaatacccgtactagacgat
attgaagggctgctggcgttaccattcgttgagcgcagtaaaaaagtactcggcgcatgg
cttgcctctgagttaggccaagatgcggtcgatgaattagttgagcgtgcctttaacttc
gatttacctttggttgccgtcgatgagcagcgcgcttgcctcgaattattccacggtcca
acactggcgtttaaagattttggggcgcgttttatggcgcaatgcgttaatgcctttgtg
ggcgacacgcgtttaaccattttgactgcgacctcgggcgacactggcgcagcggttgcc
gatgccttctatgggcttgagaaagtcaatgtggtggtgctctatcctaagggcaagatc
agtgagctgcaggaaaagatgttcacgacgttgggcaagaatatccatacagtcgccgtc
tcgtccgatttcgatgcctgccaagatctcgttaagcgcgcctttgatgatccagaagtc
cgtgatggtctgagcttgaattcggctaactctatcaatatcagccgcttactcgcgcaa
atttgctattactttgaagcggttgcccagtctaaacaacgccatgaagccgatcctgtg
atttcagtgccaagtggtaactttggcaatctcaccgcaggtttattcgctaaagccatg
ggattaccggttaaacgctttatcgctgcgaccaatgccaacgatacagtgccgcgttat
ttagacaatggccaatggcagcccaatccgactcaagcgactatgtccaatgccatggat
gtgagtgagcccagtaattggccgcgagtggaagccatttgtgagaaattaggctggcca
ctgagtaatttggttgggatccgtttatcggaggaacaaacgtcacaggcgctggtcgag
ttacacgctcaaggttatgtgtctgagcctcacgcggcgattgcggctaaggcgttatct
ttaaccttagtgcccgatgaagtgggaatattcctcgggactgcccatcctgctaaattt
aaggatgtagtggatagggagttaaatcttaacttaccgctaccagtcgagcttgaagct
gttgccaataagcctatcttatcggcggaattagcacctgattttatcgaattaaaagca
catctatttaaagtattggtttaa

DBGET integrated database retrieval system