KEGG   Shewanella putrefaciens 200: Sput200_2879Help
Entry
Sput200_2879      CDS       T02015                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
shp  Shewanella putrefaciens 200
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sput200_2879
   00240 Pyrimidine metabolism
    Sput200_2879
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Sput200_2879
   03430 Mismatch repair
    Sput200_2879
   03440 Homologous recombination
    Sput200_2879
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Sput200_2879
DNA replication proteins [BR:shp03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Sput200_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3246623..3247135
Genome map
AA seq 170 aa AA seqDB search
MTQALFYLMPPVAQSGHIAIQSAISTVANTNVALGAMHLFACQLAQQAYIKQQLVYIHCQ
DKNLALEIDELLWQFEPTAFVPHNLKGEGPITGAPVEIGFDRLGANKSRQLLINIADQAP
PFAVNFGQIIDFVANDDQHKAVARERYRQYRDLGIELTTHNLATHPLNLV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcgctgttttatctgatgccaccagtggcacaatctggtcatatcgcgatc
cagtcagccataagcactgtagccaataccaatgtggctttaggagcaatgcaccttttt
gcatgtcaattagctcagcaagcttatattaagcaacaattagtctatattcattgtcaa
gacaaaaacttagctttagagattgatgaattattatggcaatttgagccaacagcattc
gtacctcacaacttgaaaggtgaaggacctatcactggtgccccagttgaaataggtttt
gaccgccttggggccaataaaagtcgtcaacttctgattaatattgcagaccaagccccc
ccatttgcggtaaactttggtcaaatcatcgattttgttgccaatgacgatcagcataaa
gccgttgcccgtgaacgctataggcaatatcgcgacctagggatcgaattaacgacccat
aatttagcaacacatccacttaatttagtttga

DBGET integrated database retrieval system