KEGG   Shewanella putrefaciens 200: Sput200_2964Help
Entry
Sput200_2964      CDS       T02015                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sput200_2964
Enzymes [BR:shp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sput200_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3355742..3357073)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALSPAEIQFFVQGITTNAVSEGQIAAFGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNETEARAKL
NRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADAKGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKIDSSTPIAVIHAQSEAAFTEAENAVKKA
IHIGETAPEKTPEIYAYIRAADL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctaagtcctgca
gaaatacagttttttgttcaaggtatcactactaacgcagtatccgaaggccagatcgct
gcattcggtatggcagtgtactttaatgacatgaatatggatgaaagaatcgctttgacg
acggcaatgcgtgattctggcactgtacttaattggcaatcattgggactcaatggccct
gttatcgacaaacacagcactggcggtgtgggcgatgtgattagccttatgcttggccct
atggctgcggcttgtggtggttatgtgccaatgatttcaggacgtggcctaggccatacg
ggcggcacgctcgataagtttgatgcgattccaggttatcaaactgagccatcaagcgaa
ctatttcgcaaagtcgttaaagaggtcggtgtcgccattattggtcagacaggtgatctc
gttcctgccgataaacgcttctattctatccgtgataataccgctaccgttgaatctatt
tcactcatcacagcgtcgattctgtctaagaaattagcctgcaatttagatgcactcgct
atggatgtaaaagtcggtagtggcgcttttatgcctacctatgaggcttctgaagagtta
gcgcgcagtattactgctgtagccaatggtgcgggaacgaagaccacagcattactgacc
gacatgaaccaagtgttagcctcctgtgccggtaacgcggttgaagtgaaagaagccatt
gacttcttaacgggggcttaccgtaacccacgtctatatgaagtgactatgggcctttgt
gctgagatgttgctccttggcggtcttgcaagcaatgaaactgaggctcgcgctaaactc
aatcgtgttttggataacggccgcgccgctgaaatttttggcaagatggtctcagggctt
ggtgggccagtcgattttgttgaaaactacagtaagtacctgccgcaatcacagattatt
cgccctgtatttgccgatgcaaagggttatgcctatagcatggatacccgagagcttggt
ttagccgtggtgactctcggtggtggccgcagaaagcctggcgatgcactagactatagt
gttggtttaacccaagtctgtgcccttggtgataaaattgattcatcaacgcctattgcc
gttatccacgcacagtctgaagctgcctttacagaagcggaaaatgcggtgaaaaaagcg
attcacataggtgaaaccgccccagaaaaaacacctgagatctacgcttacattcgtgca
gcggatctttaa

DBGET integrated database retrieval system