KEGG   Shewanella putrefaciens 200: Sput200_2981Help
Entry
Sput200_2981      CDS       T02015                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sput200_2981
   01230 Biosynthesis of amino acids
    Sput200_2981
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sput200_2981
   00051 Fructose and mannose metabolism
    Sput200_2981
   00562 Inositol phosphate metabolism
    Sput200_2981
Enzymes [BR:shp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sput200_2981
Exosome [BR:shp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sput200_2981
  Exosomal proteins of bladder cancer cells
   Sput200_2981
  Exosomal proteins of melanoma cells
   Sput200_2981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3376615..3377397)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcagcatta
gcacaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctaagtcaacacgactttggc
gcttataccggagaagtttcaggtcagatgctaaaagattcaggatgtcgatatgtgatt
atcggacattcagaacgtcgccgtatgtacggagagacgagtaatattgtagcggagaaa
ttcgccgctgcacaaaagcacggcttaaccccaatattgtgtgtgggagagtcaggtcca
gcgcgtgaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcctacgagccattatgggcagta
gggacaggtaaaagcgctacaccagagcaggctcaagaagttcatgcgtttattcgcaaa
cgtctctctgaggtatctccatttatcggagaaaatatcaggattctctacggtggtagt
gtgacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system