KEGG   Shewanella putrefaciens 200: Sput200_2981Help
Entry
Sput200_2981      CDS       T02015                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00010  Glycolysis / Gluconeogenesis
shp00051  Fructose and mannose metabolism
shp00562  Inositol phosphate metabolism
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
shp01130  Biosynthesis of antibiotics
shp01200  Carbon metabolism
shp01230  Biosynthesis of amino acids
Module
shp_M00002  Glycolysis, core module involving three-carbon compounds
shp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sput200_2981
   00051 Fructose and mannose metabolism
    Sput200_2981
   00562 Inositol phosphate metabolism
    Sput200_2981
Enzymes [BR:shp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sput200_2981
Exosome [BR:shp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sput200_2981
  Exosomal proteins of bladder cancer cells
   Sput200_2981
  Exosomal proteins of melanoma cells
   Sput200_2981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV55383
UniProt: E6XJ90
Position
complement(3376615..3377397)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcagcatta
gcacaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctaagtcaacacgactttggc
gcttataccggagaagtttcaggtcagatgctaaaagattcaggatgtcgatatgtgatt
atcggacattcagaacgtcgccgtatgtacggagagacgagtaatattgtagcggagaaa
ttcgccgctgcacaaaagcacggcttaaccccaatattgtgtgtgggagagtcaggtcca
gcgcgtgaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcctacgagccattatgggcagta
gggacaggtaaaagcgctacaccagagcaggctcaagaagttcatgcgtttattcgcaaa
cgtctctctgaggtatctccatttatcggagaaaatatcaggattctctacggtggtagt
gtgacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system