KEGG   Shewanella putrefaciens 200: Sput200_3083Help
Entry
Sput200_3083      CDS       T02015                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00330  Arginine and proline metabolism
shp00332  Carbapenem biosynthesis
shp01100  Metabolic pathways
shp01130  Biosynthesis of antibiotics
shp01230  Biosynthesis of amino acids
Module
shp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sput200_3083
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Sput200_3083
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sput200_3083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADV55480
UniProt: E6XKQ9
Position
complement(3485915..3487033)
Genome map
AA seq 372 aa AA seqDB search
MNLSEIAYRRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMKSGIEVVLCTSGAIAAG
REHLQYPTLPDTMANKQLLAAVGQSQLILAWAQLFSIYGLHVGQLLLTRADLQDRERYLN
ARDTLNALLANNIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRTNPNAKLISQVVKIDDSLRMLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASG
HHPDVIKKVVGKESVGTHFSAIENPLESRKQWILAGPATQGSLVLDAGAVKAVTDKGRSL
LSKGIIGVKGEFERGATLQLVDQQGKVIAKGITRYCGQALNLIAGKHSDEIESVLGYDYG
DAIVHRNDMVVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaagtgagattgcgtatcgccgcgtggtagtgaaattgggaacgagtgtgctg
acctctggcagtaaacagctagataaagcccatatggttgagctggctcgtcaaatggct
gcactgatgaagtcagggatcgaagtcgttttatgcacctcaggggcgattgccgctggg
cgtgaacatctccaatacccgacactgcccgacactatggccaataagcagttgttagcc
gctgtcgggcaaagtcagttgatcctcgcttgggcacaactctttagtatttatgggctg
catgtgggccaactcttgctaacccgcgccgacttacaggatagagaacgttatctcaat
gctagagatacactcaatgcattgttggcaaacaatattatcccgatcatcaatgaaaat
gatgccgtggctaccaacgagattaaagtcggtgataatgataatttatcggcccgcgcg
gcgctgctgtgtgatgctgatttattgattttattgacggatcaaaaggggttgttcgat
gccgatccgcgcactaatccgaatgctaaattgatttcgcaggtggtgaagattgatgac
agtctgcggatgttagcgggtggttctgtatcgggtttaggtacgggcggtatgtcgact
aaactggaagccgctgatattgctcgccgtgccgggattgaggtggtgattgcctcaggt
catcaccccgatgtgattaaaaaagtggttggtaaagagtccgttggtactcactttagt
gccattgaaaacccgctcgaaagccgtaaacagtggatattggcgggccctgcaactcaa
ggctctttagtgctcgatgctggtgcggtaaaagccgttaccgataagggccgtagcttg
ttgtctaaaggtattatcggcgttaagggcgaatttgaacgtggtgcaacgctgcaatta
gttgaccaacaaggtaaagtaattgctaaggggataacgaggtattgtggtcaagccttg
aatttgattgcgggtaaacattccgacgagatcgagtcagtactaggttacgattatggt
gacgcaatagtgcaccgaaacgacatggtggtcctataa

DBGET integrated database retrieval system