KEGG   Shewanella putrefaciens 200: Sput200_3154Help
Entry
Sput200_3154      CDS       T02015                                 

Definition
Phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
shp  Shewanella putrefaciens 200
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sput200_3154
   00565 Ether lipid metabolism
    Sput200_3154
   00590 Arachidonic acid metabolism
    Sput200_3154
   00591 Linoleic acid metabolism
    Sput200_3154
   00592 alpha-Linolenic acid metabolism
    Sput200_3154
Enzymes [BR:shp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Sput200_3154
    3.1.1.32  phospholipase A1
     Sput200_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3560938..3561819
Genome map
AA seq 293 aa AA seqDB search
MNLFYKNIPLIGLLMCSGLNAESLVEGRVKDELATAERPFVITPHHVNYLLPATYNPDPN
IAPFLEEMAQDPYTLDKFEAKFQISFKFPVWYNVFGDNGHLFFAYTNQSYWQVYNKETSS
PFRETNHEPEIFMLFNNDWKIGSVTNSFWGFGAVHQSNGKSGLLSRSWNRIYGTMIFDAG
PLAFATKIWWRIPEDEKTDPYQTSGDDNPNIEDYVGNAEFIGVYGVDEHRFTLTLRSNLQ
DIDRGSAELTWSYPIVGNLRLYTQYFNGYGESLIDYNYHNQRIGIGISLNDIL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgttttataaaaatatcccgttaataggattgctaatgtgctcagggctaaat
gcagaatcattggtagaaggacgcgttaaagatgaacttgccactgcagaacgtccattt
gtgatcaccccgcatcatgtcaattatttactgccagcgacctataatcctgatcctaat
attgctccttttcttgaagaaatggctcaagatccctataccttagataaatttgaggct
aagtttcagataagctttaaatttccggtttggtacaacgtatttggtgacaatgggcat
ctattctttgcttataccaatcaatcctattggcaagtgtataacaaagaaacctcttca
ccctttcgcgaaaccaatcacgaacccgaaatatttatgctgtttaataacgattggaaa
attggcagtgtgaccaattctttttggggttttggtgcggtacatcaatctaatggtaaa
tctggcctactttctcgaagctggaatcggatttatggcaccatgatttttgatgccggt
ccactcgctttcgcaaccaaaatttggtggcgtattcccgaagatgaaaaaaccgatccc
tatcagacaagcggtgatgacaacccaaatattgaagactatgtaggcaatgccgaattt
atcggtgtttatggcgttgatgaacacagattcaccctcaccctcagaagcaatctacaa
gatatcgatcgcggctcagcagagctcacgtggagctatccaatagtggggaatttacgt
ctgtatacccaatattttaatggctatggagaaagtttaatcgactacaactatcacaac
caacgtattggaatagggatttcgcttaatgacatcctctaa

DBGET integrated database retrieval system