KEGG   Shewanella putrefaciens 200: Sput200_3241Help
Entry
Sput200_3241      CDS       T02015                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
shp  Shewanella putrefaciens 200
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3672777..3673259
Genome map
AA seq 160 aa AA seqDB search
MTRVYVALGANLNDPKTQLDNAVIALSNLAQGNSLLVSPYYHSTPMGDVVQPDYINAVAS
FETTLTPLALLDALQYIENTQGRVRKERWGPRTLDLDLLLYGNEFIDEPRLKVPHYGMKE
RSFVLVPLAAIAPDLILPCNTVLSSLIDKNMLAELQQLGH
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtttatgttgcattaggggctaatcttaatgatcccaaaacgcaattggac
aatgccgtgatagcattgtccaaccttgctcagggcaacagtttgcttgtctcaccttac
tatcactccaccccgatgggcgatgtggtccaacccgattatatcaatgcggtggcaagc
tttgagacaacattaactccactcgccttactcgatgcattgcaatatatcgaaaacacc
caagggcgagtacgtaaagaacgctggggaccaagaaccttagatcttgatctgctgcta
tatggcaatgagtttattgatgagcctaggttaaaagtacctcactacggtatgaaagaa
cgcagctttgttcttgttccactggccgcgattgctccagatcttatcctgccctgtaac
acagtcctaagtagtcttatcgacaaaaatatgttggccgagttacaacaactggggcat
tga

DBGET integrated database retrieval system