KEGG   Shewanella putrefaciens 200: Sput200_3297Help
Entry
Sput200_3297      CDS       T02015                                 

Definition
periplasmic alkaline phosphatase, PhoA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:shp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:shp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3742157..3743479
Genome map
AA seq 440 aa AA seqDB search
MSFTKAPLLLLGIGLLLSTSTWANIETGPTKAPSRPKNIVIMIGDGMGPAYTSAYRYYKD
NPDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQP
LPTILEKAKSLGLSTGVAVTSQINHATPAAFLAHNESRKNYDAIALSYLETNADVFLGGG
QKYFSPELLAQFTAKGYQHITRFDDLATITQPKVLGLFAEVQLPWAIDEKEAKKLSTLTQ
KALSLLSQNEQGFVLLVEGSLIDWAGHNNDIATVMGEMDEFSNAIEVVEQFVRQNPDTLM
VITADHNTGGLSIGANGNYNWNPEILRNISASSDTLALAAISGDEWQADLARGLGFELSE
EEVTKLNVARMQGLETMAIAIRHVIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQD
NTDIANKILSLLPKPKKSKS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactcttgttgctcggcataggcttattgctatcgacttcg
acttgggcaaacatcgaaacaggcccaacaaaagcaccatctcgcccgaaaaatatcgtc
attatgataggtgatggtatggggcctgcttatacgagcgcctatcgttactacaaagat
aatccagataccgaagaagtcgaacaaaccgtattcgaccgtttactggtgggtatggcg
agtacctatcccgccagtgtcagtggctatgttaccgactctgcggccgccgcaaccgcg
ctcgccacaggcgttaaatcgtataatggggcgatttcagttgatactcaaaagcaacca
ctaccgaccatactcgaaaaagccaaatcccttggcttaagcacaggcgtagctgttaca
tcacaaatcaaccatgccacgccagcggcatttttggcccataatgaaagccgtaaaaac
tacgatgcgatagcactcagttatttagaaactaatgccgatgtatttttaggtggcggt
caaaagtatttctcacccgagctgctagcgcaatttacagctaaaggctatcaacacatc
acccgttttgatgatctcgccactatcacccaacctaaagtgttaggtctgtttgccgag
gtgcaattgccttgggccattgatgaaaaagaagctaaaaaactcagcaccttaacccag
aaagcccttagtttactctcacaaaatgaacaagggtttgtactcttagttgaagggagt
ttaatcgactgggcgggccataataatgacatagcgactgtgatgggggaaatggatgag
ttctctaatgccattgaagtggttgaacaatttgttcgccaaaatccagacacgctaatg
gtcattaccgccgaccacaatactggaggtctatcgattggtgccaatggtaactacaac
tggaatcccgaaattctgcgaaatatttctgccagttcagacaccttagctttagccgcc
attagcggagatgaatggcaagctgatctcgcccgtggtttaggatttgagcttagcgaa
gaagaagtgaccaaattaaatgttgccagaatgcaggggttagaaaccatggccatcgcg
attcgccatgttatcgataaacgtacagatacaggatggacaactgacggccacacaggt
acagatgtacaagtctttgctgcaggtcctgcatcagagctgtttaacggccatcaggac
aatacggatattgccaataagatcttaagtttattgccaaaaccgaagaaatccaaaagt
taa

DBGET integrated database retrieval system