KEGG   Shewanella putrefaciens 200: Sput200_3297Help
Entry
Sput200_3297      CDS       T02015                                 

Definition
periplasmic alkaline phosphatase, PhoA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sput200_3297
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sput200_3297
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sput200_3297
Enzymes [BR:shp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sput200_3297
Exosome [BR:shp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sput200_3297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3742157..3743479
Genome map
AA seq 440 aa AA seqDB search
MSFTKAPLLLLGIGLLLSTSTWANIETGPTKAPSRPKNIVIMIGDGMGPAYTSAYRYYKD
NPDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQP
LPTILEKAKSLGLSTGVAVTSQINHATPAAFLAHNESRKNYDAIALSYLETNADVFLGGG
QKYFSPELLAQFTAKGYQHITRFDDLATITQPKVLGLFAEVQLPWAIDEKEAKKLSTLTQ
KALSLLSQNEQGFVLLVEGSLIDWAGHNNDIATVMGEMDEFSNAIEVVEQFVRQNPDTLM
VITADHNTGGLSIGANGNYNWNPEILRNISASSDTLALAAISGDEWQADLARGLGFELSE
EEVTKLNVARMQGLETMAIAIRHVIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQD
NTDIANKILSLLPKPKKSKS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactcttgttgctcggcataggcttattgctatcgacttcg
acttgggcaaacatcgaaacaggcccaacaaaagcaccatctcgcccgaaaaatatcgtc
attatgataggtgatggtatggggcctgcttatacgagcgcctatcgttactacaaagat
aatccagataccgaagaagtcgaacaaaccgtattcgaccgtttactggtgggtatggcg
agtacctatcccgccagtgtcagtggctatgttaccgactctgcggccgccgcaaccgcg
ctcgccacaggcgttaaatcgtataatggggcgatttcagttgatactcaaaagcaacca
ctaccgaccatactcgaaaaagccaaatcccttggcttaagcacaggcgtagctgttaca
tcacaaatcaaccatgccacgccagcggcatttttggcccataatgaaagccgtaaaaac
tacgatgcgatagcactcagttatttagaaactaatgccgatgtatttttaggtggcggt
caaaagtatttctcacccgagctgctagcgcaatttacagctaaaggctatcaacacatc
acccgttttgatgatctcgccactatcacccaacctaaagtgttaggtctgtttgccgag
gtgcaattgccttgggccattgatgaaaaagaagctaaaaaactcagcaccttaacccag
aaagcccttagtttactctcacaaaatgaacaagggtttgtactcttagttgaagggagt
ttaatcgactgggcgggccataataatgacatagcgactgtgatgggggaaatggatgag
ttctctaatgccattgaagtggttgaacaatttgttcgccaaaatccagacacgctaatg
gtcattaccgccgaccacaatactggaggtctatcgattggtgccaatggtaactacaac
tggaatcccgaaattctgcgaaatatttctgccagttcagacaccttagctttagccgcc
attagcggagatgaatggcaagctgatctcgcccgtggtttaggatttgagcttagcgaa
gaagaagtgaccaaattaaatgttgccagaatgcaggggttagaaaccatggccatcgcg
attcgccatgttatcgataaacgtacagatacaggatggacaactgacggccacacaggt
acagatgtacaagtctttgctgcaggtcctgcatcagagctgtttaacggccatcaggac
aatacggatattgccaataagatcttaagtttattgccaaaaccgaagaaatccaaaagt
taa

DBGET integrated database retrieval system