KEGG   Shewanella putrefaciens 200: Sput200_3313Help
Entry
Sput200_3313      CDS       T02015                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
shp  Shewanella putrefaciens 200
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sput200_3313
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sput200_3313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3766216..3767127
Genome map
AA seq 303 aa AA seqDB search
MSQILIIGSANADHVMKFEYLPAAGQTLMSREYRLEHGGKGANQAVACARLAKPDTHIDF
ICRLGKDSVGDDMLQSWLKDGISAEGITQTSNMSTGTAMIFIGDNGENTIGVAAGANADL
LPEDLENYYALFANAQYLLIQLETPLTTVAKALQMAKRLGVTTVLNPAPAKVLGPNYLQW
VDIITPNETEAAALTGVEINHLDDAHLAAQLLHQQGVGIVVITLGAKGAYISSPHFTGLV
PAINVQAVDTVAAGDTFNGALVVGLSEGMSIDAAVGFANAASAITVTRQGAQRAIPYRHE
VPN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatactcattatcggcagtgccaatgccgaccatgtgatgaaatttgaatac
ctacccgccgcaggacaaaccttgatgagccgagaataccgtcttgaacacggtggtaag
ggagcaaatcaagcggttgcctgcgcacgtttagccaagccagatacgcacattgatttt
atctgccgcttaggtaaagacagcgtcggcgatgatatgctccaaagctggctaaaagac
ggcattagtgcagaagggatcactcaaacatccaatatgagtactggaacggccatgatt
tttatcggtgacaacggtgaaaataccattggcgttgccgcaggtgctaatgcggatctg
ttacctgaagatttagaaaattattatgccctatttgcgaatgcacagtacctgcttatc
cagttagaaaccccattgacgacggtagcaaaagcgctacaaatggcgaaaagactgggt
gttacgacagtattaaaccctgctccagccaaagtattaggacctaattatcttcagtgg
gtggatattattaccccaaatgaaaccgaagccgcggcactgactggcgtcgagattaat
cacctcgatgatgcgcatctcgccgcacaattgctgcatcaacagggcgtaggtattgtg
gttatcactttaggggcaaagggtgcttatatcagcagtcctcattttactgggctcgta
cccgccatcaatgtacaagccgttgataccgttgcggcgggtgatacctttaatggtgct
ttagttgtcgggttaagtgagggaatgtcgattgatgctgccgtgggatttgccaatgcc
gccagcgccataacggtgactcgccaaggcgcacaaagagccatcccctaccgccacgaa
gtccctaactag

DBGET integrated database retrieval system