KEGG   Shewanella putrefaciens 200: Sput200_3318Help
Entry
Sput200_3318      CDS       T02015                                 

Definition
Ca(2+)-dependent phospholipase D, PhoD (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:shp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:shp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3770947..3772710)
Genome map
AA seq 587 aa AA seqDB search
MNRTVTRRDFLAMSAKGVGVAVISYGLMGCSDNDDNAVPAQFLHGVASGDPAHDAVILWT
RVTPESQGDVKVSWQVASDAAFSQLVTTGETVTNASRDYTVKVDARGLRAGQHYFYRFKT
GDKTSALGQTQTLPEGEVSSVKLAVLSCSNFPAGYFNVYELAAAQTDLAAVVHLGDYIYE
YPRGGYASEHAAELGREVLPANELLSLSDYRTRYGQYRTDASLQKLHAKVPFITVWDDHE
VANDTWRDGAENHNEDEGDFTARKEAALQAYFEWLPIRPWREGNHEEIYRSFSYGNLVDL
HMLDTRVLARDKQLDYADYMDATTGTFDGERFLTDVTSTSRTLLGLTQLLWLQGTLLQAT
GKWQVLGQQVLMGKMSLPAAIATQQMSIPQFAMLGALAKLAARAAANDPTLTAQELQYLQ
ANQALLTPEVLALLQLPSIPYNLDAWDGYAYEREVILGTAKSKNLNLVVIAGDTHNAWAS
ELKDMKGDTVGVEFATSSVSSPGLEYYLNLPAEQIPATEAAIVELVPDLKYTNLKDRGFM
TLTFTPDAVRSDWHYVDTILSKDFQLATARSYSAVTKAGEHTINPVS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtaccgtgactcgtcgtgattttctggctatgtcggccaaaggtgttggcgtt
gctgttatttcctacggcttgatgggctgtagtgataatgatgataatgctgtccccgcg
caatttcttcatggggtagccagcggcgatccagcacatgatgccgttatcctatggact
cgtgtaacacccgagtcacaaggtgatgtgaaagtgagttggcaagtggcgagtgatgcg
gcgttttcacagttagtcactacgggggaaacggtgactaatgccagccgtgattacacg
gttaaagtggatgcccgtggtttacgtgcagggcaacactatttttaccgctttaagacg
ggggataaaacttcagcgttaggtcaaacccaaactttgccagaaggtgaagtcagctca
gtaaagttagccgtactttcttgttctaattttcctgcgggttactttaacgtgtatgag
ttagcggcggcgcagaccgatttagctgctgtggtgcacttaggggattacatttacgaa
tatcctcgcggtggttatgccagtgaacatgcggcagaattgggccgagaagtgcttccc
gccaatgagttattgagcttaagcgattatcgtacccgttatggccagtaccgcaccgat
gcgagtttgcaaaaattacacgccaaagtgccttttatcacggtatgggatgaccatgaa
gtcgctaacgatacatggcgtgatggtgctgaaaatcacaacgaagatgaaggggatttt
actgctcgtaaagaagcggcattacaggcttattttgagtggctgcccattcgcccatgg
cgtgaaggcaaccatgaggagatttaccgcagctttagttacggtaacttagtggatcta
catatgctcgatacccgcgtgttagcgcgggataaacagctcgattatgctgattatatg
gatgccactacaggcacctttgatggcgagcgttttcttacggatgtgacatcgacctcg
cgtacgttattaggtttgacacagttattatggttgcaaggtacattattacaggcaacg
ggtaagtggcaggtgttaggtcagcaagtgttaatgggtaaaatgtcattacctgcggcg
attgcgactcagcagatgagcattccccaatttgctatgttaggggctttagctaagtta
gcggcgcgtgcagcggccaatgatcccaccttaacggcccaagaattacaatatctccaa
gccaaccaagccttattaaccccagaagtgttagccctgctgcaattgccatcgattccc
tataacttagatgcttgggatggttatgcctatgagcgtgaagtgattttaggtacggct
aaatcgaaaaatctcaacctagtggtgattgcgggtgatacccataacgcttgggcgagt
gagcttaaagatatgaagggcgatactgttggtgtggagtttgcgacgagttcggtatcc
tcgccggggcttgagtattatttgaatctccccgcagaacagatcccggcaaccgaagcg
gcgattgtcgagttagtgccagatcttaagtacaccaacttgaaagaccgcggctttatg
acgctgacattcactcccgatgcggtgcgcagcgattggcattatgtggacacgattttg
tcgaaggatttccaacttgcaacggcgcgtagttacagtgcggtgactaaagcgggtgag
cacacgattaatcctgtgagttaa

DBGET integrated database retrieval system